| General Information |
| MoonProt ID | 315 |
| First appeared in release | 2.0 |
| Name(s) | chloroplast dihydrolipoamide acetyltransferase (DLA,
E2), DLA2 pyruvate dehydrogenase complex subunit in chloroplast Gene: DLA2 |
| UniProt ID | A8J7F6 (A8J7F6_CHLRE) |
| GO terms | GO:0008152 metabolic process
GO:0004742 dihydrolipoyllysine-residue acetyltransferase activity
GO:0016740 transferase activity
GO:0016746 transferase activity, transferring acyl groups |
| Organisms for which functions have been demonstrated | Chlamydomonas reinhardtii (unicellular green alga)(Chlamydomonas smithii) |
| Sequence length | 405 amino acids |
| FASTA sequence | >tr|A8J7F6|A8J7F6_CHLRE Dihydrolipoamide acetyltransferase OS=Chlamydomonas reinhardtii GN=DLA2 PE=3 SV=1
MQATTRVPAKSGVSSSAKRVAASGRRVLVVPNAVKDVFMPALSSTMTEGKIVSWLKNVGDKVKKGEALVVVESDKADMDVESFADGILGAIVVQEGERAVVGAPIAFVAENANEAPAAAPAPAPAPVAAPAPPAPTPVPAAPVGRADGRIVATPYAKQLAKDLKVDLATVAGTGPNGRITAADATTVSELRGTTKPFSTLQAAVARNMNESLKVPEFRVSYAITTDKLDALYQQLKPKGVTMTALLAKACGVALAKHPLLYAACTPDGNGITYSSQINVALAVAMPDGGLITPVLKNADSTDLYQMSRNWADLVKRARSKQLQPDEYNSGNFTISNLGMYGVETFDAILPPGTAAIMAVGGSKPTVVASPDGMIGVKKVMNVNLTADHRIVYGADAAEFLQTLKAVIENPDQLLF |
| Structure Information |
| PDB ID | none, closest homologue has 30.56% similarity to Homo sapeins, Chain 0, Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial 6CT0 |
| Quaternary structure | part of large multiprotein pyruvate dehydrogenase complex, and also part of a different complex with mRNA, which complex it enters in depends on whether light or acetate is being used as an energy source |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-29, 53-59 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, pyruvate dehydrogenase complex subunit in chloroplast, dihydrolipoamide acetyltransferase (DLA2), helps provide acetyl-CoA for fatty acid synthesis |
| References for function | 23424285 |
| E.C. number | 2.3.1.12 |
| Location of functional site(s) | |
| Cellular location of function | chloroplast, complex with RNA in acetate and light-dependent manner |
| Comments | |
| Function 2 |
| Function description | |
| References for function | |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |