Protein Information

General Information
MoonProt ID315
First appeared in release2.0
Name(s)chloroplast dihydrolipoamide acetyltransferase (DLA, E2), DLA2 pyruvate dehydrogenase complex subunit in chloroplast Gene: DLA2
UniProt IDA8J7F6 (A8J7F6_CHLRE)
GO termsGO:0008152 metabolic process GO:0004742 dihydrolipoyllysine-residue acetyltransferase activity GO:0016740 transferase activity GO:0016746 transferase activity, transferring acyl groups
Organisms for which functions have been demonstratedChlamydomonas reinhardtii (unicellular green alga)(Chlamydomonas smithii)
Sequence length405 amino acids
FASTA sequence>tr|A8J7F6|A8J7F6_CHLRE Dihydrolipoamide acetyltransferase OS=Chlamydomonas reinhardtii GN=DLA2 PE=3 SV=1 MQATTRVPAKSGVSSSAKRVAASGRRVLVVPNAVKDVFMPALSSTMTEGKIVSWLKNVGDKVKKGEALVVVESDKADMDVESFADGILGAIVVQEGERAVVGAPIAFVAENANEAPAAAPAPAPAPVAAPAPPAPTPVPAAPVGRADGRIVATPYAKQLAKDLKVDLATVAGTGPNGRITAADATTVSELRGTTKPFSTLQAAVARNMNESLKVPEFRVSYAITTDKLDALYQQLKPKGVTMTALLAKACGVALAKHPLLYAACTPDGNGITYSSQINVALAVAMPDGGLITPVLKNADSTDLYQMSRNWADLVKRARSKQLQPDEYNSGNFTISNLGMYGVETFDAILPPGTAAIMAVGGSKPTVVASPDGMIGVKKVMNVNLTADHRIVYGADAAEFLQTLKAVIENPDQLLF
Structure Information
PDB ID
Quaternary structurepart of large multiprotein pyruvate dehydrogenase complex, and also part of a different complex with mRNA, which complex it enters in depends on whether light or acetate is being used as an energy source
Function 1
Function descriptionenzyme, pyruvate dehydrogenase complex subunit in chloroplast, dihydrolipoamide acetyltransferase (DLA2), helps provide acetyl-CoA for fatty acid synthesis
References for function23424285
E.C. number2.3.1.12
Location of functional site(s)
Cellular location of functionchloroplast, complex with RNA in acetate and light-dependent manner
Comments
Function 2
Function description
References for function
E.C. number
Location of functional site(s)
Cellular location of function
Comments