General Information |
MoonProt ID | 350 |
First appeared in release | 2.0 |
Name(s) | glutathione S-transferase, GST, GST Mu, Glutathione S-transferase Mu, Class mu glutathione S-transferase |
UniProt ID | Q9MZB4 (Q9MZB4_CAPHI) |
GO terms | GO:0008152 metabolic process
GO:0004364 glutathione transferase activity
GO:0016740 transferase activity |
Organisms for which functions have been demonstrated | Capra hircus (goat, a mammal) |
Sequence length | 188 amino acids |
FASTA sequence | >tr|Q9MZB4|Q9MZB4_CAPHI Class mu glutathione S-transferase (Fragment) OS=Capra hircus PE=2 SV=1
RLLLEYTDSNYEEKKYTMGDAPDYDRSQWLNEKSKLGLDFPNLPYLIDGTHKLTQSNAILRHIARKYNMCGETEEEKIRVDLLENQVMDVRLHMARICYSPDFEKLKPGYLKEIPGRMKLFSVFLGKRCWFAGNKLTYVDFLAYDILDLQRIFEPRCLDEFRNLKDFLTRFEGLKKISGYMKSSRFLP |
Structure Information |
PDB ID | |
Quaternary structure | |
SCOP | |
CATH | |
TM Helix Prediction | no TM helices |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | 185-188 |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | glutathione S-transferase, detoxify electrophilic compounds |
References for function | 11973347 |
E.C. number | 2.5.1.18 |
Location of functional site(s) | |
Cellular location of function | catalytically active on sperm plasma membrane |
Comments | |
Function 2 |
Function description | binds ZP3 protein component of zona pellucida, serves as a gamete recognition molecule, binds specifically to zona pellucida (of egg) during the first phase of sperm–oocyte interactions |
References for function | 11973347 |
E.C. number | |
Location of functional site(s) | |
Cellular location of function | surface of sperm plasma membrane, attached by non-covalent methods |
Comments | anti-GST antibodies prevent fertilization but not GST catalytic activity |