Protein Information

General Information
MoonProt ID366
First appeared in release2.0
Name(s)lactate dehydrogenase isozyme M, LDH M, L-lactate dehydrogenase A chain, LDH muscle subunit, LDH-M, LDH-A, Gene: Ldha
UniProt IDP06151 (LDHA_MOUSE)
GO termsGO:0005975 carbohydrate metabolic process GO:0019244 lactate biosynthetic process from pyruvate GO:0019661 glucose catabolic process to lactate via pyruvate GO:0019752 carboxylic acid metabolic process GO:0031668 cellular response to extracellular stimulus GO:0055114 oxidation-reduction process GO:0003824 catalytic activity GO:0004457 lactate dehydrogenase activity GO:0004459 L-lactate dehydrogenase activity GO:0005515 protein binding GO:0016491 oxidoreductase activity GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor GO:0005634 nucleus GO:0005737 cytoplasm GO:0005739 mitochondrion GO:0005829 cytosol GO:0016020 membrane GO:0035686 sperm fibrous sheath GO:0070062 extracellular exosome
Organisms for which functions have been demonstratedMus musculus (mouse)
Sequence length332 amino acids
FASTA sequence>sp|P06151|LDHA_MOUSE L-lactate dehydrogenase A chain OS=Mus musculus GN=Ldha PE=1 SV=3 MATLKDQLIVNLLKEEQAPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLKTPKIVSSKDYCVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPHCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGISDVVKVTLTPEEEARLKKSADTLWGIQKELQF
Structure Information
PDB IDNone, but rat, human, rabbit in PDB
Quaternary structuretetramer
Function 1
Function descriptionenzyme, lactate + NAD+ -> pyruvate + NADH
References for function
E.C. number1.1.1.27
Location of functional site(s)Rossman fold
Cellular location of functioncytoplasm
Commentsupregulation of LDH seen in some cancers, but not clear which function (or both) involved
Function 2
Function descriptionRNA binding protein, post-transcriptional regulation of gene expression, AU-rich element (ARE, binding to these kinds of elements can be involved in affecting RNA stability) binding protein (AUBP), role may also involve binding to AUF1 protein, binds the 3 -UTR of GM-CSF RNA
References for function12107167
E.C. number
Location of functional site(s)Rossman fold also involved in this function, so probably cannot perform both functions simultaneously, binding to RNA competed by NAD+
Cellular location of function
Comments