| General Information |
| MoonProt ID | 369 |
| First appeared in release | 2.0 |
| Name(s) | PAPS-red A, phosphoadenosine-phosphosulfate reductase, Gene: GSTUM_00002663001 |
| UniProt ID | D5G7U8 (D5G7U8_TUBMM) |
| GO terms | GO:0008152 metabolic process
GO:0019379 sulfate assimilation, phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin)
GO:0055114 oxidation-reduction process
GO:0003824 catalytic activity
GO:0004604 phosphoadenylyl-sulfate reductase (thioredoxin) activity |
| Organisms for which functions have been demonstrated | Tuber melanosporum (Perigord black truffle, filamentous mycorrhizal ascomycetous fungus) |
| Sequence length | 273 amino acids |
| FASTA sequence | >tr|D5G7U8|D5G7U8_TUBMM Uncharacterized protein OS=Tuber melanosporum (strain Mel28) GN=GSTUM_00002663001 PE=4 SV=1
MPDVYFSSPHLKYLNQQLQTLEPEEILKWCMISLPNLFQTTAFGLTGLVTLDMLSRINAGAPRQIDLIFLDTLYHFDETLELVDRVRERYPNSKLHIYKPSGCANARDFECIHGDNLWDTNDNLYDYLAKVEPAQRAYAELNVKAVLTGRRKSQGGKRGDLDIIGLDDAGLIKVNPLANWTFKQVREYVTKYNVPYNSLLDMGYKSIGDWHSTSPIAEGEDERSGRWKGTNKTECGIHNHRSKYAEYLLQQEQKKNGEALVDALHEVGLQWAI |
| Structure Information |
| PDB ID | |
| Quaternary structure | |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-6, 250-261, 265-266, 268-273 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | phosphoadenosine-phosphosulfate reductase (thioredoxin), enzyme in sulfur assimilation, conversion of activated sulfate (PAPS) to sulfite, adenosine 3',5'-bisphosphate + sulfite + thioredoxin disulfide <-> 3'-phosphoadenylyl sulfate + thioredoxin |
| References for function | Levati E, Sartini S, Bolchi A, Ottonello S, Montanini B. Moonlighting transcriptional activation function of a fungal sulfur metabolism enzyme. Sci Rep. 2016 6:25165. doi: 10.1038/srep25165. PMID: 27121330. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | Levati and coworkers note it "is expressed at high levels in fruiting bodies, where sulfur assimilation is also involvedin the production of secondary sulfur metabolites (S-Volatile Organic Compounds; S-VOCs) as components of the truffle aroma." |
| Function 2 |
| Function description | transcription factor |
| References for function | 27121330 |
| E.C. number | |
| Location of functional site(s) | C-terminal polypeptide containing an alternating hydrophilic/hydrophobic amino acid motif involved |
| Cellular location of function | nucleus |
| Comments | transcription factor function not found in PAPS-red B variant, which has 99% sequence identity |