General Information |
MoonProt ID | 370 |
First appeared in release | 2.0 |
Name(s) | 2-cys class peroxiredoxin, mitochondrial 2-cysteine peroxiredoxin, mTXNPx, peroxidoxin Gene: mTXNPx |
UniProt ID | Q95U89 (Q95U89_LEIIN) |
GO terms | GO:0055114 oxidation-reduction process
GO:0098869 cellular oxidant detoxification
GO:0004601 peroxidase activity
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0051920 peroxiredoxin activity |
Organisms for which functions have been demonstrated | Leishmania infantum |
Sequence length | 226 amino acids |
FASTA sequence | >tr|Q95U89|Q95U89_LEIIN Peroxidoxin OS=Leishmania infantum GN=mTXNPx PE=4 SV=1
MLRRLPTSCFLKRSQFRGFAATSPLLNLDYQMYRTATVREAAPQFSGQAVVNGAIKDINMNDYKGKYIVLFFYPMDFTFVCPTEIIAFSDRHADFEKLNTQVVAVSCDSVYSHLAWVNTPRKKGGLGEMHIPVLADKSMEIARDYGVLIEESGIALRGLFIIDKKGILRHSTINDLPVGRNVDEALRVLEAFQYADENGDAIPCGWKPGQPTLDTTKAGEFFEKNM |
Structure Information |
PDB ID | None, but close homologue Leishmania braziliensis with 89% amino acid sequence identity |
Quaternary structure | |
SCOP | NA |
CATH | NA |
TM Helix Prediction | no TM helices |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | 1-15, 219-220, 222-226 |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | peroxidase activity, detoxification of reactive oxygen species (ROS), removal of peroxide, use redox active cysteine residue (peroxidatic Cys) to reduce substrates like H2O2 |
References for function | Castro H., Sousa C., Santos M., Cordeiro-da-Silva A., Flohe L., Tomas A.M. Complementary antioxidant defense by cytoplasmic and mitochondrial peroxiredoxins in Leishmania infantum. Free Radic. Biol. Med. 33:1552-1562(2002). PMID: 12446213 |
E.C. number | 1.11.1.- |
Location of functional site(s) | |
Cellular location of function | mitochondria |
Comments | |
Function 2 |
Function description | chaperone and activators of signal transduction cascades, prevents thermal aggregation of citrate synthase in vitro, lack of expression makes promastigoes more sensitive to temperature in the mammalian host (37°C) |
References for function | 22046130 |
E.C. number | |
Location of functional site(s) | |
Cellular location of function | |
Comments | |