| General Information |
| MoonProt ID | 370 |
| First appeared in release | 2.0 |
| Name(s) | 2-cys class peroxiredoxin, mitochondrial 2-cysteine peroxiredoxin, mTXNPx, peroxidoxin Gene: mTXNPx |
| UniProt ID | Q95U89 (Q95U89_LEIIN) |
| GO terms | GO:0055114 oxidation-reduction process
GO:0098869 cellular oxidant detoxification
GO:0004601 peroxidase activity
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0051920 peroxiredoxin activity |
| Organisms for which functions have been demonstrated | Leishmania infantum |
| Sequence length | 226 amino acids |
| FASTA sequence | >tr|Q95U89|Q95U89_LEIIN Peroxidoxin OS=Leishmania infantum GN=mTXNPx PE=4 SV=1
MLRRLPTSCFLKRSQFRGFAATSPLLNLDYQMYRTATVREAAPQFSGQAVVNGAIKDINMNDYKGKYIVLFFYPMDFTFVCPTEIIAFSDRHADFEKLNTQVVAVSCDSVYSHLAWVNTPRKKGGLGEMHIPVLADKSMEIARDYGVLIEESGIALRGLFIIDKKGILRHSTINDLPVGRNVDEALRVLEAFQYADENGDAIPCGWKPGQPTLDTTKAGEFFEKNM |
| Structure Information |
| PDB ID | None, but close homologue Leishmania braziliensis with 89% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-15, 219-220, 222-226 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | peroxidase activity, detoxification of reactive oxygen species (ROS), removal of peroxide, use redox active cysteine residue (peroxidatic Cys) to reduce substrates like H2O2 |
| References for function | Castro H., Sousa C., Santos M., Cordeiro-da-Silva A., Flohe L., Tomas A.M. Complementary antioxidant defense by cytoplasmic and mitochondrial peroxiredoxins in Leishmania infantum. Free Radic. Biol. Med. 33:1552-1562(2002). PMID: 12446213 |
| E.C. number | 1.11.1.- |
| Location of functional site(s) | |
| Cellular location of function | mitochondria |
| Comments | |
| Function 2 |
| Function description | chaperone and activators of signal transduction cascades, prevents thermal aggregation of citrate synthase in vitro, lack of expression makes promastigoes more sensitive to temperature in the mammalian host (37°C) |
| References for function | 22046130 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |