General Information |
MoonProt ID | 372 |
First appeared in release | 2.0 |
Name(s) | peroxiredoxin 5, Gene: PRDX5 |
UniProt ID | Q9GLW8 (Q9GLW8_PIG) |
GO terms | GO:0055114 oxidation-reduction process
GO:0016491 oxidoreductase activity |
Organisms for which functions have been demonstrated | Sus scrofa (pig) |
Sequence length | 162 amino acids |
FASTA sequence | >tr|Q9GLW8|Q9GLW8_PIG Peroxiredoxin 5 OS=Sus scrofa GN=PRDX5 PE=2 SV=1
MAPIKVGDAIPSVVVFEGEPEKKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGIQVVACLSVNDVFVTEMWGRAHNTEGKVRLLADPTGAFGKETDLLLDDSLVSLFGNRRLKRFSMVIEDGIVKSLNVEPDDTGLTCSLAPNIISQL |
Structure Information |
PDB ID | |
Quaternary structure | |
SCOP | |
CATH | |
TM Helix Prediction | no TM helices |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | peroxiredoxin |
References for function | |
E.C. number | 1.11.1.15 |
Location of functional site(s) | |
Cellular location of function | cytoplasm |
Comments | |
Function 2 |
Function description | sperm plasma membrane protein interacting with zona pellucida proteins |
References for function | 17483085 |
E.C. number | |
Location of functional site(s) | |
Cellular location of function | sperm plasma membrane |
Comments | |