| General Information |
| MoonProt ID | 381 |
| First appeared in release | 2.0 |
| Name(s) | pyruvate dehydrogenase E2 subunit, pyruvate dehydrogenase complex E2 component, dihydrolipoamide acetyltransferase, Gene: pdhC |
| UniProt ID | Q6HEJ4 (Q6HEJ4_BACHK) |
| GO terms | GO:0008152 metabolic process
GO:0004742 dihydrolipoyllysine-residue acetyltransferase activity
GO:0016740 transferase activity
GO:0016746 transferase activity, transferring acyl groups |
| Organisms for which functions have been demonstrated | Bacillus thuringiensis |
| Sequence length | 429 amino acids |
| FASTA sequence | >tr|Q6HEJ4|Q6HEJ4_BACHK Pyruvate dehydrogenase complex E2 component, dihydrolipoamide acetyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pdhC PE=3 SV=1
MAFEFKLPDIGEGIHEGEIVKWFIKPGDEVNEDDVLLEVQNDKAVVEIPSPVKGKVLEVLVEEGTVAVVGDTLIKFDAPGYENLKFKGDDHDEAPKAEEAKEEAPKAEATPAATAEVVNERVIAMPSVRKYARENGVDIHKVAGSGKNGRIVKADIDAFANGGQAVAATEAPAAVEATPAAAKEEAPKAQPIPAGEYPETREKMSGIRKAIAKAMVNSKHTAPHVTLMDEVDVTELVAHRKKFKAVAADKGIKLTYLPYVVKALTSALREYPMLNTSLDDASQEVVHKHYFNIGIAADTDKGLLVPVVKDTDRKSIFTISNEINDLAGKAREGRLAPAEMKGASCTITNIGSAGGQWFTPVINHPEVAILGIGRIAEKPVVKNGEIVAAPVLALSLSFDHRLIDGATAQKALNQIKRLLNDPQLLVMEA |
| Structure Information |
| PDB ID | 3DUF |
| Quaternary structure | |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-2, 77-121, 162-195, 428-429 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | pyruvate dehydrogenase E2 subunit, dihydrolipoamide acetyltransferase |
| References for function | |
| E.C. number | 2.3.1.12 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | DNA binding, transcription regulation |
| References for function | 10075684 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | binding to DNA |
| Comments | |