Protein Information

General Information
MoonProt ID381
First appeared in release2.0
Name(s)pyruvate dehydrogenase E2 subunit, pyruvate dehydrogenase complex E2 component, dihydrolipoamide acetyltransferase, Gene: pdhC
UniProt IDQ6HEJ4 (Q6HEJ4_BACHK)
GO termsGO:0008152 metabolic process GO:0004742 dihydrolipoyllysine-residue acetyltransferase activity GO:0016740 transferase activity GO:0016746 transferase activity, transferring acyl groups
Organisms for which functions have been demonstratedBacillus thuringiensis
Sequence length429 amino acids
FASTA sequence>tr|Q6HEJ4|Q6HEJ4_BACHK Pyruvate dehydrogenase complex E2 component, dihydrolipoamide acetyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pdhC PE=3 SV=1 MAFEFKLPDIGEGIHEGEIVKWFIKPGDEVNEDDVLLEVQNDKAVVEIPSPVKGKVLEVLVEEGTVAVVGDTLIKFDAPGYENLKFKGDDHDEAPKAEEAKEEAPKAEATPAATAEVVNERVIAMPSVRKYARENGVDIHKVAGSGKNGRIVKADIDAFANGGQAVAATEAPAAVEATPAAAKEEAPKAQPIPAGEYPETREKMSGIRKAIAKAMVNSKHTAPHVTLMDEVDVTELVAHRKKFKAVAADKGIKLTYLPYVVKALTSALREYPMLNTSLDDASQEVVHKHYFNIGIAADTDKGLLVPVVKDTDRKSIFTISNEINDLAGKAREGRLAPAEMKGASCTITNIGSAGGQWFTPVINHPEVAILGIGRIAEKPVVKNGEIVAAPVLALSLSFDHRLIDGATAQKALNQIKRLLNDPQLLVMEA
Structure Information
PDB ID3DUF
Quaternary structure
Function 1
Function descriptionpyruvate dehydrogenase E2 subunit, dihydrolipoamide acetyltransferase
References for function
E.C. number2.3.1.12
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionDNA binding, transcription regulation
References for function10075684
E.C. number
Location of functional site(s)
Cellular location of functionbinding to DNA
Comments