| General Information |
| MoonProt ID | 387 |
| First appeared in release | 2.0 |
| Name(s) | DNA-directed RNA polymerase beta subunit, Gene: rpoB |
| UniProt ID | A0EKJ1 (A0EKJ1_STRGN) |
| GO terms | GO:0006351 transcription, DNA-templated
GO:0003677 DNA binding
GO:0003899 DNA-directed RNA polymerase activity
GO:0032549 ribonucleoside binding |
| Organisms for which functions have been demonstrated | Streptococcus gordonii (Gram positive bacterium) |
| Sequence length | 226 amino acids |
| FASTA sequence | >tr|A0EKJ1|A0EKJ1_STRGN DNA-directed RNA polymerase (Fragment) OS=Streptococcus gordonii GN=rpoB PE=3 SV=1
PNVGEDALRNLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDTSLRVPHGADGVVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVFDGASSDDLWDTVREAGMDSDAKTVLYDGRTGEPFDNRVSVGVMYMIK |
| Structure Information |
| PDB ID | none, structures of some homologues are available |
| Quaternary structure | forms RNAP catalytic core with 2 alpha, 1 beta, 1 beta' and 1 omega subunits |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-8 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | beta subunit of DNA-directed RNA polymerase |
| References for function | |
| E.C. number | 2.7.7.6 |
| Location of functional site(s) | |
| Cellular location of function | associated with DNA in cell |
| Comments | |
| Function 2 |
| Function description | Muc7 binding protein |
| References for function | 19671172 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |