| General Information |
| MoonProt ID | 391 |
| First appeared in release | 2.0 |
| Name(s) | superoxide dismutase, sod1, Superoxide dismutase [Cu-Zn] Gene: SOD1 |
| UniProt ID | P00445 (SODC_YEAST) |
| GO terms | GO:0001320 age-dependent response to reactive oxygen species involved in chronological cell aging
GO:0006801 superoxide metabolic process
GO:0006878 cellular copper ion homeostasis
GO:0006882 cellular zinc ion homeostasis
GO:0019430 removal of superoxide radicals
GO:0031505 fungal-type cell wall organization
GO:0036091 positive regulation of transcription from RNA polymerase II promoter in response to oxidative stress
GO:0050821 protein stabilization
GO:0051091 positive regulation of sequence-specific DNA binding transcription factor activity
GO:0055114 oxidation-reduction process
GO:0098869 cellular oxidant detoxification
GO:1901856 negative regulation of cellular respiration
GO:0004784 superoxide dismutase activity
GO:0005507 copper ion binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space
GO:0005829 cytosol |
| Organisms for which functions have been demonstrated | Saccharomyces cerevisiae (yeast, fungi) |
| Sequence length | 154 amino acids |
| FASTA sequence | >sp|P00445|SODC_YEAST Superoxide dismutase [Cu-Zn] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOD1 PE=1 SV=2
MVQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN |
| Structure Information |
| PDB ID | 1F1G, 1F1A, 1F18, 1SDY, 1F1D, 1JK9, 1B4T |
| Quaternary structure | |
| SCOP | Cu,Zn superoxide dismutase-like |
| CATH | 2.60.40.200 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | none |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | superoxide dismutase, catalysis of superoxide (O2-) to hydrogen peroxide (H2O2), remove reactive oxygen species, 2 superoxide -> oxygen and H2O2 |
| References for function | 3290902 |
| E.C. number | 1.15.1.1 |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |
| Function 2 |
| Function description | binds DNA, transcription factor in response to H2O2, a reactive oxygen species (ROS), regulates expression of genes involved in oxidative resistance and DNA damage repair, ROS treatment increases Sod1 binding to the promoters of RNR3 and GRE2 |
| References for function | 24647101 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | regulation of sod1 by phosphorylation at serine 60 and 99 |