Protein Information

General Information
MoonProt ID395
First appeared in release
Name(s)voltage-dependent anion channel 2, VDAC2, voltage-dependent anion-selective channel protein 2, outer mitochondrial membrane protein porin 2, VDAC-2, hVDAC2, Gene: VDAC2
UniProt IDP45880 (VDAC2_HUMAN)
GO termsGO:0006810 transport GO:0006811 ion transport GO:0006820 anion transport GO:0032272 negative regulation of protein polymerization GO:0044070 regulation of anion transport GO:0055085 transmembrane transport GO:1903959 regulation of anion transmembrane transport GO:2001243 negative regulation of intrinsic apoptotic signaling pathway GO:0000166 nucleotide binding GO:0005515 protein binding GO:0008308 voltage-gated anion channel activity GO:0015288 porin activity GO:0005634 nucleus GO:0005739 mitochondrion GO:0005741 mitochondrial outer membrane GO:0005743 mitochondrial inner membrane GO:0008021 synaptic vesicle GO:0016020 membrane GO:0016021 integral component of membrane GO:0042645 mitochondrial nucleoid GO:0043209 myelin sheath GO:0045121 membrane raft GO:0046930 pore complex GO:0070062 extracellular exosome
Organisms for which functions have been demonstratedHomo sapiens, human
Sequence length294 amino acids
FASTA sequence>sp|P45880|VDAC2_HUMAN Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens GN=VDAC2 PE=1 SV=2 MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionvoltage-dependent anion channel 2 (VDAC2), transports adenine nucleotides, Ca2+ and other metabolites, voltage-dependent
References for function8420959
E.C. number
Location of functional site(s)
Cellular location of functionmitochondrial outer membrane, transmembrane protein
Comments
Function 2
Function descriptionbinds to rhZP2 or rhZP3, zona pellucida proteins of egg
References for function23355646
E.C. number
Location of functional site(s)
Cellular location of functionsperm membrane
Comments