| General Information |
| MoonProt ID | 395 |
| First appeared in release | |
| Name(s) | voltage-dependent anion channel 2, VDAC2, voltage-dependent anion-selective channel protein 2, outer mitochondrial membrane protein porin 2, VDAC-2, hVDAC2, Gene: VDAC2 |
| UniProt ID | P45880 (VDAC2_HUMAN) |
| GO terms | GO:0006810 transport
GO:0006811 ion transport
GO:0006820 anion transport
GO:0032272 negative regulation of protein polymerization
GO:0044070 regulation of anion transport
GO:0055085 transmembrane transport
GO:1903959 regulation of anion transmembrane transport
GO:2001243 negative regulation of intrinsic apoptotic signaling pathway
GO:0000166 nucleotide binding
GO:0005515 protein binding
GO:0008308 voltage-gated anion channel activity
GO:0015288 porin activity
GO:0005634 nucleus
GO:0005739 mitochondrion
GO:0005741 mitochondrial outer membrane
GO:0005743 mitochondrial inner membrane
GO:0008021 synaptic vesicle
GO:0016020 membrane
GO:0016021 integral component of membrane
GO:0042645 mitochondrial nucleoid
GO:0043209 myelin sheath
GO:0045121 membrane raft
GO:0046930 pore complex
GO:0070062 extracellular exosome |
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal) |
| Sequence length | 294 amino acids |
| FASTA sequence | >sp|P45880|VDAC2_HUMAN Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens GN=VDAC2 PE=1 SV=2
MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA |
| Structure Information |
| PDB ID | |
| Quaternary structure | |
| SCOP | |
| CATH | |
| TM Helix Prediction | beta barrel TM protein |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-6), and C terminus (aa 290-294) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | voltage-dependent anion channel 2 (VDAC2), transports adenine nucleotides, Ca2+ and other metabolites, voltage-dependent |
| References for function | 8420959 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | mitochondrial outer membrane, transmembrane protein |
| Comments | |
| Function 2 |
| Function description | binds to rhZP2 or rhZP3, zona pellucida proteins of egg |
| References for function | 23355646 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | sperm membrane |
| Comments | |