| General Information |
| MoonProt ID | 3971 |
| First appeared in release | 4.0 |
| Name(s) | Histone acetyltransferase Tip60 |
| UniProt ID | Q960X4 |
| GO terms | GO:0000123 histone acetyltransferase complex, GO:0000256 IEA, GO:0000724 double-strand break repair via homologous recombination, GO:0000785 chromatin, GO:0000812 Swr1 complex, GO:0003682 chromatin binding, GO:0004402 histone acetyltransferase activity, GO:0005634 nucleus, GO:0005705 polytene chromosome interband, GO:0006281 DNA repair, GO:0006325 chromatin organization, GO:0006338 chromatin remodeling, GO:0006355 regulation of DNA-templated transcription, GO:0006974 DNA damage response, GO:0007399 nervous system development, GO:0008270 zinc ion binding, GO:0010468 regulation of gene expression, GO:0016740 transferase activity, GO:0016746 acyltransferase activity, GO:0032991 protein-containing complex, GO:0035267 NuA4 histone acetyltransferase complex, GO:0043524 negative regulation of neuron apoptotic process, GO:0045893 positive regulation of DNA-templated transcription, GO:0046872 metal ion binding, GO:0046972 histone H4K16 acetyltransferase activity, GO:0048167 regulation of synaptic plasticity, GO:0061733 protein-lysine-acetyltransferase activity, GO:0140861 DNA repair-dependent chromatin remodeling, GO:1990188 euchromatin binding, GO:2000331 regulation of terminal button organization |
| Organisms for which functions have been demonstrated | Drosophila melanogaster (fruit fly) |
| Sequence length | 541.0 |
| FASTA sequence | ">sp|Q960X4|TIP60_DROME Histone acetyltransferase Tip60 OS=Drosophila melanogaster OX=7227 GN=Tip60 PE=1 SV=1
MKINHKYEFDDDVASICESTAALTEGCRLPVRMHKTDDWPLAEIVSIKELDGRRQFYVHY
VDFNKRLDEWVNEEDLYTRKVQFPRRDGSQTGTSTGVTTPQRHHSLAGSVSRPTSPQHPG
SGALAAIPQTPTGASGSVPPPAGIPNSVAPPGTPSSGGELVNGNNLAAALQKRINRKRKN
HGGSAHGHHSLTSQQQQSHPHPTTPQTPTATPVHVTGDGLISGAANDDGDGSQDGKTPTP
RQSGSMVTHQDDVVTRMKNVEMIELGRHRIKPWYFSPYPQELCQMPCIYICEFCLKYRKS
RKCLERHLSKCNLRHPPGNEIYRKHTISFFEIDGRKNKVYAQNLCLLAKLFLDHKTLYYD
TDPFLFYVMTEFDSRGFHIVGYFSKEKESTEDYNVACILTMPPYQRKGYGKLLIEFSYEL
SKFEGKTGSPEKPLSDLGLLSYRSYWAQTILEIFISQNPSTDGEKPTITINDICECTSIK
KEDVISTLQNLNLINYYKGQYIVCINRVIIEQHRRAMDKRKIRIDSKCLHWTPKDWSKRS
K" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | Component of the Tip60 chromatin-remodeling complex which contains the catalytic subunit Tip60 and the subunits Domino, Tra1, Brd8, E(Pc), DMAP1, Pontin, Reptin, Ing3, Act87E, BAP55, Mrg15, MrgBP, Gas41 and YL-1. |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | component of DOM/TIP60 chromatin remodeling complex |
| References for function | _ |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |
| Function 2 |
| Function description | localizes to the meiotic spindle during meiosis |
| References for function | Prozzillo, Y., Fattorini, G., Ferreri, D., Leo, M., Dimitri, P., & Messina, G. (2023). Knockdown of DOM/Tip60 Complex Subunits Impairs Male Meiosis of Drosophila melanogaster. Cells, 12(10), 1348. https://doi.org/10.3390/cells12101348 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | localizes to the meiotic spindle during meiosis |
| Comments | |