| General Information |
| MoonProt ID | 3974 |
| First appeared in release | 4.0 |
| Name(s) | Brahma associated protein 55kD - Bap55 |
| UniProt ID | Q7K012 |
| GO terms | GO:0000278 mitotic cell cycle, GO:0000812 Swr1 complex, GO:0003682 chromatin binding, GO:0005634 nucleus, GO:0006338 chromatin remodeling, GO:0006357 regulation of transcription by RNA polymerase II, GO:0007399 nervous system development, GO:0035060 brahma complex, GO:0035267 NuA4 histone acetyltransferase complex, GO:0045893 positive regulation of DNA-templated transcription, GO:0070983 dendrite guidance, GO:0140861 DNA repair-dependent chromatin remodeling, GO:0016514 SWI/SNF complex |
| Organisms for which functions have been demonstrated | Drosophila melanogaster (fruit fly) |
| Sequence length | 425.0 |
| FASTA sequence | ">tr|Q7K012|Q7K012_DROME Brahma associated protein 55kD OS=Drosophila melanogaster OX=7227 GN=Bap55 PE=1 SV=1
MSGGTMLYGGDEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVGIGAAPETNLDPETKTD
NNATPNNADQRKFYVDTNYVTVPRSNMEVQTYMKDGMIDNWDLFEKVIDYAYANVIQSEP
EYHPVLFSEASWNVRNNREKLTELMFEKYNVPAFFLVKNAVLAAFSSGRATALVVDSGAT
HTSAVPVHEGYVLSQAVVKSPLGGDFLSRQCRQHLEKHGIDLSPVYKIASKDVVKERDNG
RFTLRKLPENLTQSWQNYMLQLMMQDFQMNVLQVLENPFDERVAAQIPTVHYEFPNGYHQ
DFGSERFKIAESLFDNAMLGAGQLASTSVGMCDADVRLSLFGSVVVTGGNTLLQGFPERL
NRDLQLRAPSNTRLKMISANGSVERRFGAWIGGSILASIGTFQQMWISSQEYEEAGKSQV
ERKCP" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | component of DOM/TIP60 chromatin remodeling complex |
| References for function | _ |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |
| Function 2 |
| Function description | localizes to the spindle (alpha-tubulin) of the meiotic apparatus during meiosis |
| References for function | Prozzillo, Y., Fattorini, G., Ferreri, D., Leo, M., Dimitri, P., & Messina, G. (2023). Knockdown of DOM/Tip60 Complex Subunits Impairs Male Meiosis of Drosophila melanogaster. Cells, 12(10), 1348. https://doi.org/10.3390/cells12101348 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | localizes to the spindle (alpha-tubulin) of the meiotic apparatus during meiosis |
| Comments | |