| General Information |
| MoonProt ID | 3977 |
| First appeared in release | 4.0 |
| Name(s) | Vibrio parahaemolyticus serotype O3:K6 |
| UniProt ID | Q87LQ0 |
| GO terms | GO:0000287 magnesium ion binding, GO:0004634 phosphopyruvate hydratase activity, GO:0016829 lyase activity, GO:0046872 metal ion binding, GO:0006096 glycolytic process, GO:0007155 cell adhesion, GO:0005576 extracellular region, GO:0005737 cytoplasm, GO:0009279 cell outer membrane, GO:0009986 cell surface, GO:0000015 phosphopyruvate hydratase complex |
| Organisms for which functions have been demonstrated | Vibrio parahaemolyticus serotype O3:K6 |
| Sequence length | 433.0 |
| FASTA sequence | ">sp|Q87LQ0|ENO_VIBPA Enolase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=eno PE=1 SV=1
MSKIVKVLGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKARFL
GKGVLKAIEAVNGPIAEALVGKDAKDQAAIDAVMIELDGTENKSKFGANAILAVSLANAK
AAAAAKGMPLYEHIAELNGTAGQFSMPLPMMNIINGGEHADNNVDIQEFMIQPVGAATLK
EAVRMGAEVFHNLAKVLKSKGYNTAVGDEGGFAPNLKSNAEALEVIAEAVAAAGYELGKD
VTLAMDCAASEFFDKEAGIYNMKGEGKTFTSEEFNHYLAGLVEQFPIVSIEDGLDESDWD
GFAHQTQLLGDKIQLVGDDLFVTNTKILAEGIEKGIANSILIKFNQIGSLTETLAAIKMA
KDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGER
APFNGLKEVKGQA" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | multiprotein complex |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, enolase, 2-phospho-D-glycerate => phosphoenolpyruvate + H2O Catalyzes the reversible conversion of 2-phosphoglycerate into phosphoenolpyruvate. Carbohydrate degradation, glycolysis |
| References for function | Jiang, W., Han, X., Wang, Q., Li, X., Yi, L., Liu, Y., & Ding, C. (2014). Vibrio parahaemolyticus enolase is an adhesion-related factor that binds plasminogen and functions as a protective antigen. Applied microbiology and biotechnology, 98(11), 4937–4948. https://doi.org/10.1007/s00253-013-5471-z |
| E.C. number | EC:4.2.1.11 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds plasminogen |
| References for function | Jiang, W., Han, X., Wang, Q., Li, X., Yi, L., Liu, Y., & Ding, C. (2014). Vibrio parahaemolyticus enolase is an adhesion-related factor that binds plasminogen and functions as a protective antigen. Applied microbiology and biotechnology, 98(11), 4937–4948. https://doi.org/10.1007/s00253-013-5471-z |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |