| General Information |
| MoonProt ID | 3980 |
| First appeared in release | 4.0 |
| Name(s) | Oryza sativa subsp. japonica (Rice) |
| UniProt ID | Q8LQ68 |
| GO terms | GO:0000166 nucleotide binding, GO:0004340 glucokinase activity, GO:0004396 hexokinase activity, GO:0005524 ATP binding, GO:0005536 D-glucose binding, GO:0008865 fructokinase activity, GO:0016301 kinase activity, GO:0016740 transferase activity, GO:0016773 phosphotransferase activity, alcohol group as acceptor, GO:0001678 intracellular glucose homeostasis, GO:0005975 carbohydrate metabolic process, GO:0006006 glucose metabolic process, GO:0006096 glycolytic process, GO:0009749 response to glucose, GO:0019318 hexose metabolic process, GO:0046835 carbohydrate phosphorylation, GO:0051156 glucose 6-phosphate metabolic process, GO:0005739 mitochondrion, GO:0005829 cytosol, GO:0009707 chloroplast outer membrane |
| Organisms for which functions have been demonstrated | Oryza sativa subsp. japonica (Rice) |
| Sequence length | 506.0 |
| FASTA sequence | ">sp|Q8LQ68|HXK6_ORYSJ Hexokinase-6 OS=Oryza sativa subsp. japonica OX=39947 GN=HXK6 PE=1 SV=1
MGKGTVVGTAVVVCAAAAAAVGVAVVVSRRRRSKREAEEERRRRAAAVIEEVEQRFSTPT
ALLRGIADAMVEEMERGLRADPHAPLKMLISYVDNLPTGDEHGLFYALDLGGTNFRVIRV
QLGGREKRVVSQQYEEVAIPPHLMVGTSMELFDFIAAELESFVKTEGEDFHLPEGRQREL
GFTFSFPVHQTSISSGTLIKWTKGFSINGTVGEDVVAELSRAMERQGLDMKVTALVNDTV
GTLAGGRYVDNDVAAAVILGTGTNAAYVEHANAIPKWTGLLPRSGNMVINMEWGNFKSER
LPRSDYDNALDFESLNPGEQIYEKMISGMYLGEIVRRILLKLAHDASLFGDVVPTKLEQR
FILRTPDMSAMHHDTSHDLKHLGAKLKDILGVADTSLEARYITLHVCDLVAERGARLAAA
GIYGILKKLGRDRVPSDGSQKQRTVIALDGGLYEHYKKFRTCLEATLADLLGEEAASSVV
VKLANDGSGIGAALLAASHSQYASVE" |
| Structure Information |
| PDB ID | 5ZQT 6JJ4 6JJ7 6JJ8 6JJ9 |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, hexokinase, phosphorylates glucose in glycolysis |
| References for function | Huang W, Yu C, Hu J, Wang L, Dan Z, Zhou W, He C, Zeng Y, Yao G, Qi J, Zhang Z, Zhu R, Chen X, Zhu Y. Pentatricopeptide-repeat family protein RF6 functions with hexokinase 6 to rescue rice cytoplasmic male sterility. Proc Natl Acad Sci U S A. 2015 Dec 1;112(48):14984-9. doi: 10.1073/pnas.1511748112. Epub 2015 Nov 17. PMID: 26578814; PMCID: PMC4672834. |
| E.C. number | EC:2.7.1.1 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds to RF6 protein to aid in processing RNA transcripts |
| References for function | Huang W, Yu C, Hu J, Wang L, Dan Z, Zhou W, He C, Zeng Y, Yao G, Qi J, Zhang Z, Zhu R, Chen X, Zhu Y. Pentatricopeptide-repeat family protein RF6 functions with hexokinase 6 to rescue rice cytoplasmic male sterility. Proc Natl Acad Sci U S A. 2015 Dec 1;112(48):14984-9. doi: 10.1073/pnas.1511748112. Epub 2015 Nov 17. PMID: 26578814; PMCID: PMC4672834. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |