| General Information |
| MoonProt ID | 3985 |
| First appeared in release | 4.0 |
| Name(s) | Streptococcus suis |
| UniProt ID | A4VZZ3 |
| GO terms | GO:0000166 nucleotide binding, GO:0000287 magnesium ion binding, GO:0003746 translation elongation factor activity, GO:0003924 GTPase activity, GO:0005525 GTP binding, GO:0016787 hydrolase activity, GO:0046872 metal ion binding, GO:0006412 translation, GO:0006414 translational elongation, GO:0005737 cytoplasm, GO:0005829 cytosol |
| Organisms for which functions have been demonstrated | Streptococcus suis |
| Sequence length | 398.0 |
| FASTA sequence | ">sp|A4VZZ3|EFTU_STRS2 Elongation factor Tu OS=Streptococcus suis (strain 98HAH33) OX=391296 GN=tuf PE=3 SV=2
MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVNQPKDYASIDAAPEER
ERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDGPMPQTR
EHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVIQGSALK
ALEGDSKYEDIVMELMNTVDEYIPEPERDTDKPLLLPVEDVFSITGRGTVASGRIDRGTV
RVNDEIEIVGLQEEKSKAVVTGVEMFRKQLDEGLAGDNVGVLLRGVQRDEIERGQVISKP
GSINPHTKFKGEVYILTKEEGGRHTPFFDNYRPQFYFRTTDVTGSIKLPEGTEMVMPGDN
VTIDVELIHPIAVEQGTTFSIREGGRTVGSGMVTEIEA" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | elongation factor |
| References for function | _ |
| E.C. number | EC:3.6.5.3 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | adhesin, binds to laminin, binds to fibronectin |
| References for function | Li Q, Liu H, Du D, Yu Y, Ma C, Jiao F, Yao H, Lu C, Zhang W. Identification of Novel Laminin- and Fibronectin-binding Proteins by Far-Western Blot: Capturing the Adhesins of Streptococcus suis Type 2. Front Cell Infect Microbiol. 2015 Nov 16;5:82. doi: 10.3389/fcimb.2015.00082. Erratum in: Front Cell Infect Microbiol. 2020 Oct 29;10:593413. doi: 10.3389/fcimb.2020.593413. PMID: 26636044; PMCID: PMC4644805. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |