| General Information |
| MoonProt ID | 3986 |
| First appeared in release | 4.0 |
| Name(s) | Streptococcus suis |
| UniProt ID | A0ZNJ3 |
| GO terms | GO:0003824 catalytic activity, GO:0004459 L-lactate dehydrogenase (NAD+) activity, GO:0016491 oxidoreductase activity, GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor, GO:0006089 lactate metabolic process, GO:0006096 glycolytic process, GO:0019752 carboxylic acid metabolic process, GO:0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Streptococcus suis |
| Sequence length | 327.0 |
| FASTA sequence | ">tr|A0ZNJ3|A0ZNJ3_STRSU L-lactate dehydrogenase OS=Streptococcus suis OX=1307 GN=ldh PE=3 SV=1
MTATKQHKKVILVGDGAVGSAYAYALVNQGIGQELGIIDINKDRTQGDAEDLSHALAFTF
PKKIYSAEYSDAHDADLVVLTAGLPQKPGETRLELVEKNIRINQQIVTEIVKSGFNGIFL
VAANPVDVLTYSTWKFSGFPKERVIGSGTSLDSARFRQALAEKIGIDARSVHAYIMGEHG
DSEFAVWSHANVAGVKLYDWLQDNRDIDEQGLVDLFVSVRDAAYSIINKKGATYYGIGVA
LARITKAIFDDENAVLPLSVYQAGQYEGVEDVFIGQPAIIGAHGIVRPVNIPLSEAELQK
MQASAKQLKDIIDDAFANPEIAAGVKN" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | homotetramer |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, catalyzes the conversion of pyruvate into lactate |
| References for function | _ |
| E.C. number | EC:1.1.1.27 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | adhesin, binds to laminin, binds to fibronectin |
| References for function | Li Q, Liu H, Du D, Yu Y, Ma C, Jiao F, Yao H, Lu C, Zhang W. Identification of Novel Laminin- and Fibronectin-binding Proteins by Far-Western Blot: Capturing the Adhesins of Streptococcus suis Type 2. Front Cell Infect Microbiol. 2015 Nov 16;5:82. doi: 10.3389/fcimb.2015.00082. Erratum in: Front Cell Infect Microbiol. 2020 Oct 29;10:593413. doi: 10.3389/fcimb.2020.593413. PMID: 26636044; PMCID: PMC4644805. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |