| General Information |
| MoonProt ID | 3989 |
| First appeared in release | 4.0 |
| Name(s) | Mycoplasma pneumoniae |
| UniProt ID | P75358 |
| GO terms | GO:0000166 nucleotide binding, GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity, GO:0005515 protein binding, GO:0016491 oxidoreductase activity, GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor, GO:0050661 NADP binding, GO:0051287 NAD binding, GO:0006006 glucose metabolic process, GO:0006096 glycolytic process, GO:0031639 plasminogen activation, GO:0034394 protein localization to cell surface, GO:0005737 cytoplasm, GO:0016020 membrane |
| Organisms for which functions have been demonstrated | Mycoplasma pneumoniae |
| Sequence length | 337.0 |
| FASTA sequence | ">sp|P75358|G3P_MYCPN Glyceraldehyde-3-phosphate dehydrogenase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=gapA PE=1 SV=1
MLAKSKTIRVAINGFGRIGRLVFRALLSQKNIEIVAVNDLTHPDTLAHLLKYDSAHGEFK
KKVVAKDNTLMIDKKKVLVFSEKDPANLPWAEHNIDIVVESTGRFVSEEGASLHLQAGAK
RVIISAPAKQKTIKTVVYNVNHKIINAEDKIISAASCTTNCLAPMVHVLEKNFGILHGTM
VTVHAYTADQRLQDAPHSDLRRARAAACNIVPTTTGAAKAIGLVVPEATGKLNGMALRVP
VLTGSIVELCVALEKDATVEQINQAMKKAASASFRYCEDEIVSSDIVGSEHGSIFDSKLT
NIIEVDGNKLYKVYAWYDNESSYVNQLVRVVNYCAKL" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | homotetramer |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, glyceraldehyde 3-phosphate dehydrogenase, catalyzes the reversible oxidative phosphorylation of glyceraldehyde 3-phosphate to 1,3-bisphosphate coupled with reduction of NAD+ to NADH |
| References for function | _ |
| E.C. number | EC:1.2.1.12 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | adhesin, binds host ECM, binds lactoferrin, laminin, vitronectin, fibriongen, fibronectin, |
| References for function | Gründel A, Jacobs E, Dumke R. Interactions of surface-displayed glycolytic enzymes of Mycoplasma pneumoniae with components of the human extracellular matrix. Int J Med Microbiol. 2016 Dec;306(8):675-685. doi: 10.1016/j.ijmm.2016.09.001. Epub 2016 Sep 3. PMID: 27616280. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |