| General Information |
| MoonProt ID | 3990 |
| First appeared in release | 4.0 |
| Name(s) | Mycoplasma pneumoniae |
| UniProt ID | P75391 |
| GO terms | GO:0001968 fibronectin binding, GO:0004739 pyruvate dehydrogenase (acetyl-transferring) activity, GO:0005515 protein binding, GO:0016491 oxidoreductase activity, GO:0031639 plasminogen activation, GO:0051919 positive regulation of fibrinolysis, GO:0005829 cytosol, GO:0009897 external side of plasma membrane, GO:0009986 cell surface, GO:0016020 membrane, GO:0033111 attachment organelle membrane |
| Organisms for which functions have been demonstrated | Mycoplasma pneumoniae |
| Sequence length | 327 |
| FASTA sequence | ">sp|P75391|ODPB_MYCPN Pyruvate dehydrogenase E1 component subunit beta OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=pdhB PE=1 SV=1
MSKTIQANNIEALGNAMDLALERDPNVVLYGQDAGFEGGVFRATKGLQKKYGEERVWDCP
IAEAAMAGIGVGAAIGGLKPIVEIQFSGFSFPAMFQIFTHAARIRNRSRGVYTCPIIVRM
PMGGGIKALEHHSETLEAIYGQIAGLKTVMPSNPYDTKGLFLAAVESPDPVVFFEPKKLY
RAFRQEIPADYYTVPIGQANLISQGNNLTIVSYGPTMFDLINMVYGGELKDKGIELIDLR
TISPWDKETVFNSVKKTGRLLVVTEAAKTFTTSGEIIASVTEELFSYLKAAPQRVTGWDI
VVPLARGEHYQFNLNARILEAVNQLLK" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | multiprotein complex |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, pyruvate dehydrogenase B |
| References for function | _ |
| E.C. number | EC:1.2.4.1 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | adhesin, binds host ECM, binds lactoferrin, laminin, vitronectin, fibrinogen, |
| References for function | Gründel A, Jacobs E, Dumke R. Interactions of surface-displayed glycolytic enzymes of Mycoplasma pneumoniae with components of the human extracellular matrix. Int J Med Microbiol. 2016 Dec;306(8):675-685. doi: 10.1016/j.ijmm.2016.09.001. Epub 2016 Sep 3. PMID: 27616280. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |