| General Information |
| MoonProt ID | 3997 |
| First appeared in release | 4.0 |
| Name(s) | Streptococcus suis |
| UniProt ID | A0A6L8MWS2 |
| GO terms | GO:0000166 nucleotide binding, GO:0005524 ATP binding, GO:0016853 isomerase activity, GO:0051082 unfolded protein binding, GO:0140662 ATP-dependent protein folding chaperone, GO:0006457 protein folding, GO:0042026 protein refolding, GO:0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Streptococcus suis |
| Sequence length | 540.0 |
| FASTA sequence | ">tr|A0A6L8MWS2|A0A6L8MWS2_STRSU Chaperonin GroEL OS=Streptococcus suis OX=1307 GN=groL PE=3 SV=1
MAKEIKFAADARESMVRGVDILADTVKVTLGPKGRNVVLEKAYGSPLITNDGVTIAKEIE
LEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGLKNVTAGANPIGIRRGIE
AAVATAVEALKAQANPVSNKEEIAQVAAVSSRSEKVGEYISEAMERVGTDGVITIEESRG
METELDVVEGMQFDRGYLSQYMVTDNEKMVAELENPFILITDKKISHIQDILPLLESILQ
TNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVIT
EDLGLDLKDATIEALGQAAKVVVDKDGTTIVEGAGNPEAIANRVAVIKSQIEVTTSEFDR
EKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALVNV
IDSVAKLQLKGDDETGRNIVLRALEEPVRQIAYNAGYEGSVIIDKLKNSELGIGFNAATG
EWVNMMDAGIIDPVKVTRSALQNAASVASLILTTEAVVANKPEPAAPAMPQGMDGMGMGY" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | protein chaperone, prevents proteins from misfolding, promotes correct refolding and assembly of polypeptides |
| References for function | _ |
| E.C. number | EC:5.6.1.7 |
| Location of functional site(s) | |
| Cellular location of function | Cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds host fibronectin |
| References for function | Zhang H, Zheng J, Yi L, Li Y, Ma Z, Fan H, Lu C. The identification of six novel proteins with fibronectin or collagen type I binding activity from Streptococcus suis serotype 2. J Microbiol. 2014 Nov;52(11):963-9. doi: 10.1007/s12275-014-4311-x. Epub 2014 Oct 31. PMID: 25359271. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |