| General Information |
| MoonProt ID | 3998 |
| First appeared in release | 4.0 |
| Name(s) | Streptococcus suis (strain 98HAH33) |
| UniProt ID | A4W440 |
| GO terms | GO:0000166 nucleotide binding, GO:0000287 magnesium ion binding, GO:0004019 adenylosuccinate synthase activity, GO:0005525 GTP binding, GO:0016874 ligase activity, GO:0046872 metal ion binding, GO:0006164 purine nucleotide biosynthetic process, GO:0044208 'de novo' AMP biosynthetic process, GO:0046040 IMP metabolic process, GO:0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Streptococcus suis (strain 98HAH33) |
| Sequence length | 430.0 |
| FASTA sequence | ">sp|A4W440|PURA_STRS2 Adenylosuccinate synthetase OS=Streptococcus suis (strain 98HAH33) OX=391296 GN=purA PE=3 SV=2
MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGTKYKLHLIPSGIF
FPEKISVIGNGVVVNPKSLVKEINYLHDSGVTTDNLRISDRAHVILPYHIKLDQLQEESK
GENKIGTTNKGIGPAYMDKAARVGIRIADLLDKEIFAERLRTNLAEKNRLFEKMYESTPI
EFDEIFEEYYAYGQEIKKYVTDTSVILNDALDQGKRVLFEGAQGVMLDIDQGTYPFVTSS
NPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELHDEIGDRIREIGKEYGTTT
GRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLGTLKICVAYDLDGERIDHYPASL
EQLKRCKPIYEEMPGWSEDITGVRSLDELPEAARNYVRRISELVGVRISTFSVGPGREQT
NILESVWSAK" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, Catalyzes the first committed step in the biosynthesis of AMP from IMP, IMP + L-aspartate + GTP = N6-(1,2-dicarboxyethyl)-AMP + GDP + phosphate + 2 H+ |
| References for function | _ |
| E.C. number | EC:6.3.4.4 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds host fibronectin |
| References for function | Zhang H, Zheng J, Yi L, Li Y, Ma Z, Fan H, Lu C. The identification of six novel proteins with fibronectin or collagen type I binding activity from Streptococcus suis serotype 2. J Microbiol. 2014 Nov;52(11):963-9. doi: 10.1007/s12275-014-4311-x. Epub 2014 Oct 31. PMID: 25359271. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |