| General Information |
| MoonProt ID | 3999 |
| First appeared in release | 4.0 |
| Name(s) | Streptococcus suis (strain BM407) |
| UniProt ID | A0A0H3N648 |
| GO terms | GO:0004739 pyruvate dehydrogenase (acetyl-transferring) activity, GO:0016491 oxidoreductase activity, GO:0016624 oxidoreductase activity acting on the aldehyde or oxo group of donors disulfide as acceptor, GO:0006086 pyruvate decarboxylation to acetyl-CoA |
| Organisms for which functions have been demonstrated | Streptococcus suis (strain BM407) |
| Sequence length | 322.0 |
| FASTA sequence | ">tr|A0A0H3N648|A0A0H3N648_STRS4 Pyruvate dehydrogenase E1 component, alpha subunit OS=Streptococcus suis (strain BM407) OX=568814 GN=pdhA PE=4 SV=1
MVSITKEQHLDMFLKMQQIRDVDMKLNKLVRRGFVQGMTHFSVGEEAAAVGPIAGLTDED
IIFSHHRGHGHVIAKGIDINGMMAELAGKATGTSKGRGGSMHLANVEKGNFGSNGIVGGG
YALAVGAALTQQYLGTDNIVIAFSGDSATNEGSFHESMNLAAVWNLPVIFFITNNRYGIS
TDISYSTKIPHLYQRAAAYGIPGHYVEDGNDVIAVYEKMQEVIEYVRAGKGPAMVEVESY
RWFGHSTADAGVYRTKEEVNEWKAKDPLKKYRKYLTENKIATDEELDAIEAQVAEQVEAS
VKFAQESPDPDISVAYEDVFVD" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, Pyruvate dehydrogenase, The pyruvate dehydrogenase complex catalyzes the overall conversion pyruvate => acetyl-CoA and CO2. Pyruvate dehydrogenase (E1) is one of the enzyme components of the complex |
| References for function | _ |
| E.C. number | EC:1.2.4.1 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds host fibronectin |
| References for function | Zhang H, Zheng J, Yi L, Li Y, Ma Z, Fan H, Lu C. The identification of six novel proteins with fibronectin or collagen type I binding activity from Streptococcus suis serotype 2. J Microbiol. 2014 Nov;52(11):963-9. doi: 10.1007/s12275-014-4311-x. Epub 2014 Oct 31. PMID: 25359271. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |