| General Information |
| MoonProt ID | 4000 |
| First appeared in release | 4.0 |
| Name(s) | Streptococcus suis (strain 05ZYH33) |
| UniProt ID | A4VSN8 |
| GO terms | GO:0000166 nucleotide binding, GO:0004618 phosphoglycerate kinase activity, GO:0005524 ATP binding, GO:0016301 kinase activity, GO:0016740 transferase activity, GO:0043531 ADP binding, GO:0006094 gluconeogenesis, GO:0006096 glycolytic process, GO:0005737 cytoplasm, GO:0005829 cytosol, GO:0009986 cell surface |
| Organisms for which functions have been demonstrated | Streptococcus suis (strain 05ZYH33) |
| Sequence length | 399.0 |
| FASTA sequence | ">sp|A4VSN8|PGK_STRSY Phosphoglycerate kinase OS=Streptococcus suis (strain 05ZYH33) OX=391295 GN=pgk PE=3 SV=1
MAKLTVKDVELKGKKVLVRVDFNVPLKDGVITNDNRITAALPTIKYILEQGGRAILFSHL
GRVKEEADKEGKSLAPVAADLAAKLGQDVAFIAGATRGAELEAAINALEDGQVLLVENTR
FEDVDGKKESKNDEELGKYWASLGDGIFVNDAFGTAHRSHASNVGISANVEKAVAGFLLE
NEIAYIQEAVETPERPFVAILGGSKVSDKIGVIENLLEKADKVLIGGGMTYTFYKAQGIE
IGNSLVEEDKLDVAKTLLEKANGKLILPVDSKEANAFAGYTEVRDTDGEAVSEGFLGLDI
GPKSIAKFDEALTGAKTVVWNGPMGVFENPDFQAGTIGVMDAIVKQPGVKSIIGGGDSAA
AAINLGRADKFSWISTGGGASMELLEGKVLPGLAALTEK" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, Phosphoglycerate kinase ADP + 1,3-bisphosphoglycerate => ATP + 3-phosphoglycerate Carbohydrate degradation, glycolysis |
| References for function | _ |
| E.C. number | EC:2.7.2.3 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds host fibronectin |
| References for function | Zhang H, Zheng J, Yi L, Li Y, Ma Z, Fan H, Lu C. The identification of six novel proteins with fibronectin or collagen type I binding activity from Streptococcus suis serotype 2. J Microbiol. 2014 Nov;52(11):963-9. doi: 10.1007/s12275-014-4311-x. Epub 2014 Oct 31. PMID: 25359271. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |