| General Information |
| MoonProt ID | 4003 |
| First appeared in release | 4.0 |
| Name(s) | Homo sapiens (Human) |
| UniProt ID | Q8TE02 |
| GO terms | "GO:0000049 tRNA binding
GO:0005515 protein binding
GO:0005515 molecular_function protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0002098 tRNA wobble uridine modification
GO:0002098 tRNA wobble uridine modification
GO:0006400 tRNA modification
GO:0006417 regulation of translation
GO:0008033 tRNA processing
GO:0030335 positive regulation of cell migration
GO:0030335 positive regulation of cell migration
GO:0005634 nucleus
GO:0005829 cytosol
GO:0005634 nucleus
GO:0005634 nucleus
GO:0005654 cellular_component nucleoplasm
GO:0005737 cytoplasm
GO:0005737 cytoplasm
GO:0033588 elongator holoenzyme complex
GO:0033588 elongator holoenzyme complex
GO:0033588 elongator holoenzyme complex
GO:0033588 elongator holoenzyme complex" |
| Organisms for which functions have been demonstrated | Homo sapiens (Human) |
| Sequence length | 300.0 |
| FASTA sequence | ">sp|Q8TE02|ELP5_HUMAN Elongator complex protein 5 OS=Homo sapiens OX=9606 GN=ELP5 PE=1 SV=3
MLDSLLALGGLVLLRDSVEWEGRSLLKALVKKSALCGEQVHILGCEVSEEEFREGFDSDI
NNRLVYHDFFRDPLNWSKTEEAFPGGPLGALRAMCKRTDPVPVTIALDSLSWLLLRLPCT
TLCQVLHAVSHQDSCPGDSSSVGKVSVLGLLHEELHGPGPVGALSSLAQTEVTLGGTMGQ
ASAHILCRRPRQRPTDQTQWFSILPDFSLDLQEGPSVESQPYSDPHIPPVDPTTHLTFNL
HLSKKEREARDSLILPFQFSSEKQQALLRPRPGQATSHIFYEPDAYDDLDQEDPDDDLDI" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | subunit of multiprotein complex |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | subunit of the Elongator tRNA-modifying complex that regulates protein translation |
| References for function | _ |
| E.C. number | NA |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | subunit of a complex that binds alpha-beta-tubulin heterodimers to affect microtubule growth |
| References for function | Planelles-Herrero VJ, Genova M, Krüger LK, Bittleston A, McNally KE, Morgan TE, Degliesposti G, Magiera MM, Janke C, Derivery E. Elongator is a microtubule polymerase selective for polyglutamylated tubulin. EMBO J. 2025 Mar;44(5):1322-1353. doi: 10.1038/s44318-024-00358-0. Epub 2025 Jan 15. PMID: 39815006; PMCID: PMC11876699. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |