| General Information |
| MoonProt ID | 4010 |
| First appeared in release | 4.0 |
| Name(s) | Babesia bigemina |
| UniProt ID | A0A5B9RW46 |
| GO terms | GO:0000287 magnesium ion binding GO:0004634 phosphopyruvate hydratase activity GO:0016829 lyase activity GO:0046872 metal ion binding GO:0006096 glycolytic process GO:0005634 nucleus GO:0005773 vacuole GO:0005856 cytoskeleton GO:0005886 plasma membrane GO:0009986 cell surface GO:0000015 phosphopyruvate hydratase complex |
| Organisms for which functions have been demonstrated | Babesia bigemina |
| Sequence length | 442.0 |
| FASTA sequence | ">tr|A0A5B9RW46|A0A5B9RW46_BABBI Enolase OS=Babesia bigemina OX=5866 GN=EnoBb PE=3 SV=1
MASITSIHAREILDSRGNPTVEVDLATADGVFRAACPSGASTGIYEALELRDGDKARYLG
KGVLKAVNNVNTTIAAGVKGHDVRDQKGLDDLMVKKLDGSMNEWGHCKSNLGANAILVVS
MAAARAAAESKKVPLYQHLAELAGKPTDNYILPVPCLNVINGGSHAGNSLAMQEFMILPV
GAPSFREAIRMGCEVYHNLKKVINAKYGQDATNVGDEGGFAPNIKSAEEALDLLVESIKK
AGFDGQVKIAMDVAASEFYVKESSSYNLGFKCEQPCMKSGPEMVAYYKELCQKYPIVSIE
DPFDQDDWESYKMLTDEIGAAVQIVGDDLLVTNPKRIETALAKKACNALLLKVNQIGSVT
EAIDACLLSHANSWGVMVSHRSGETEDTFIADLVVALGTGQIKTGAPCRSERNAKYNQLI
RIEEQLGSRARYAGAAFRTCGN" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, glycolysis, gluconeogenesis, converts phophoenolpyruvate and 2-phospho D-glycerate |
| References for function | _ |
| E.C. number | EC:4.2.1.11 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds plasminogen |
| References for function | Laura LA, Juan M, Jacqueline CE, Mariana AI, Alma CF, Valeria Guadalupe CG, Elizbeth ÁM, Minerva CN. Babesia bigemina enolase binds to plasminogen and contains conserved B-cell epitopes that induce neutralizing antibodies in cattle. Vet Parasitol. 2025 Jul;337:110503. doi: 10.1016/j.vetpar.2025.110503. Epub 2025 May 16. Erratum in: Vet Parasitol. 2025 Jul;337:110513. doi: 10.1016/j.vetpar.2025.110513. PMID: 40403476. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |