| General Information |
| MoonProt ID | 4012 |
| First appeared in release | 4.0 |
| Name(s) | Buchnera aphidicola subsp. Macrosiphoniella ludovicianae |
| UniProt ID | Q9AQ96 |
| GO terms | " GO:0004455 ketol-acid reductoisomerase activity
GO:0016491 oxidoreductase activity
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0046872 metal ion binding
GO:0050661 NADP binding
GO:0008652 amino acid biosynthetic process
GO:0009082 branched-chain amino acid biosynthetic process
GO:0009097 isoleucine biosynthetic process
GO:0009099 L-valine biosynthetic process
GO:0005829 cytosol" |
| Organisms for which functions have been demonstrated | Buchnera aphidicola subsp. Macrosiphoniella ludovicianae |
| Sequence length | 343.0 |
| FASTA sequence | ">sp|Q9AQ96|ILVC_BUCML Ketol-acid reductoisomerase (NADP(+)) (Fragment) OS=Buchnera aphidicola subsp. Macrosiphoniella ludovicianae OX=118105 GN=ilvC PE=3 SV=1
RKNSILKKNQSWINATKNNFLVGDYESLIPNADLVINLTPDKQHSNVVKELQKLMKKDAC
LGYSHGFNIVENGETIRKDITVIMVAPKCPGTEVREEYKRGFGVPTLIAVHNENDYSNMG
LEVAKAWAFSTGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQTASLVCYEKLITTQNHP
GYAGKLIQFGWETITESLKHGGITLMMDRLSNSSKIRAFKLSQEIKRIFSKLFQKHMDDI
ISGDFSSKMIQDWKNKDQNLLNWRYKTKNTSFEQSPDYDKKILEQEYYDHGILMVAILKA
GIELSFETMIQSGIMEESAYYESLHELPLIANTIARKKLYEMN" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | ketol-acid reductoisomerase |
| References for function | ketol-acid reductoisomerase |
| E.C. number | EC 1.1.1.86 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | 2-dehydropantoate 2-reductase |
| References for function | Price DR, Wilson AC. A substrate ambiguous enzyme facilitates genome reduction in an intracellular symbiont. BMC Biol. 2014 Dec 20;12:110. doi: 10.1186/s12915-014-0110-4. PMID: 25527092; PMCID: PMC4306246. |
| E.C. number | EC 1.1.1.169 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |