| General Information |
| MoonProt ID | 4017 |
| First appeared in release | 4.0 |
| Name(s) | CLIC3, Chloride intracellular channel protein 3 |
| UniProt ID | O95833 |
| GO terms | "GO:0005254 chloride channel activity; GO:0005515 protein binding; GO:0016491 oxidoreductase activity; GO:0019153 protein-disulfide reductase (glutathione) activity; GO:0006811 monoatomic ion transport; GO:0006821 chloride transport; GO:0007165 signal transduction; GO:0034220 monoatomic ion transmembrane transport; GO:1902476 chloride transmembrane transport; GO:1903672 positive regulation of sprouting angiogenesis; GO:0005737 cytoplasm; GO:0016020 membrane; GO:0005634 nucleus; GO:0005886 plasma membrane; GO:0016604 nuclear body; GO:0031012 extracellular matrix; GO:0070062 extracellular exosome; GO:0034702 monoatomic ion channel complex; GO:0034707 chloride channel complex" |
| Organisms for which functions have been demonstrated | Homo sapiens (Human) |
| Sequence length | _ |
| FASTA sequence | ">sp|O95833|CLIC3_HUMAN Chloride intracellular channel protein 3 OS=Homo sapiens OX=9606 GN=CLIC3 PE=1 SV=2
MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGS
QLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPV
PAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKL
HIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR" |
| Structure Information |
| PDB ID | 2AHE, 2D2Z, 3OQS |
| Quaternary structure | NA |
| SCOP | "80271771Q1S C
80395561Q1S C" |
| CATH | 2aheA01, 2aheA02 |
| TM Helix Prediction | NA |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | ion channel |
| References for function | Alghalayini A, Hossain KR, Moghaddasi S, Turkewitz DR, D'Amario C, Wallach M, Valenzuela SM. In Vitro Enzymatic Studies Reveal pH and Temperature Sensitive Properties of the CLIC Proteins. Biomolecules. 2023 Sep 15;13(9):1394. doi: 10.3390/biom13091394. PMID: 37759794; PMCID: PMC10526857. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | membrane |
| Comments | |
| Function 2 |
| Function description | enzyme, glutaredoxin-like oxidoreductase |
| References for function | Alghalayini A, Hossain KR, Moghaddasi S, Turkewitz DR, D'Amario C, Wallach M, Valenzuela SM. In Vitro Enzymatic Studies Reveal pH and Temperature Sensitive Properties of the CLIC Proteins. Biomolecules. 2023 Sep 15;13(9):1394. doi: 10.3390/biom13091394. PMID: 37759794; PMCID: PMC10526857. |
| E.C. number | EC:1.8.-.- |
| Location of functional site(s) | |
| Cellular location of function | membrane |
| Comments | |