| General Information |
| MoonProt ID | 4018 |
| First appeared in release | 4.0 |
| Name(s) | Methionine aminopeptidase |
| UniProt ID | I7FJS2 |
| GO terms | "GO:0004177 aminopeptidase activity
GO:0004239 initiator methionyl aminopeptidase activity
GO:0008233 peptidase activity
GO:0008235 metalloexopeptidase activity
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
GO:0070006 metalloaminopeptidase activity
GO:0006508 proteolysis
GO:0005829 cytosol" |
| Organisms for which functions have been demonstrated | Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) |
| Sequence length | 285.0 |
| FASTA sequence | ">tr|I7FJS2|I7FJS2_MYCS2 Methionine aminopeptidase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=map PE=1 SV=1
MSVRSALRPGVLSPTLPVPKSIPRPEYAWKPTVQEGSEPWVQTPEVIEKMRVAGRIAAGA
LAEAGRAVAPGVTTDELDRIAHEYMIDHGAYPSTLGYKGFPKSCCTSLNEIICHGIPDST
VIEDGDIVNIDVTAYIDGVHGDTNATFLAGDVSEEHRLLVERTHEATMRAIKAVKPGRAL
SVVGRVIEAYANRFGYNVVRDFTGHGIGTTFHNGLVVLHYDQPAVETVLEPGMTFTIEPM
INLGTLDYEIWDDGWTVATTDGKWTAQFEHTLVVTEDGAEILTQL" |
| Structure Information |
| PDB ID | 8YP6 |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, aminopeptidase, removes N-terminal methionine from growing polypeptide chain |
| References for function | _ |
| E.C. number | EC:3.4.11.18 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | anti-association factor preventing 30S and 50S ribosomal subunits to associate, probably helps regulation translation |
| References for function | Banerjee A, Srinivasan K, Sengupta J. Mycobacterial Methionine Aminopeptidase Type 1c Moonlights as an Anti-association Factor on the 30S Ribosomal Subunit. J Mol Biol. 2025 Sep 1;437(17):169230. doi: 10.1016/j.jmb.2025.169230. Epub 2025 May 27. PMID: 40441414. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |