| General Information |
| MoonProt ID | 402 |
| First appeared in release | 3.0 |
| Name(s) | h-Type Thioredoxin, Trxs, Trx-h3, thioredoxin 3, Gene: TRX3 |
| UniProt ID | Q42403 |
| GO terms | GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor
GO:0006457 protein folding
GO:0005829 cytosol
GO:0010286 heat acclimation
GO:0009408 response to heat
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0015035 protein disulfide oxidoreductase activity
GO:0006662 glycerol ether metabolic process
GO:0045454 cell redox homeostasis
GO:0055114 oxidation-reduction process
GO:0005737 cytoplasm
GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor
GO:0005773 vacuole
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005829 cytosol
GO:0009507 chloroplast
GO:0005829 cytosol
GO:0005829 cytosol
GO:0050832 defense response to fungus
GO:0005618 cell wall
GO:0005739 mitochondrion
GO:0005886 plasma membrane
GO:0005886 plasma membrane
GO:0009506 plasmodesma
GO:0009570 chloroplast stroma
GO:0009536 plastid
GO:0010188 response to microbial phytotoxin
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Arabidopsis thaliana (Mouse-ear cress, a plant) |
| Sequence length | 118 amino acids |
| FASTA sequence | >sp|Q42403|TRXH3_ARATH Thioredoxin H3 OS=Arabidopsis thaliana OX=3702 GN=TRX3 PE=1 SV=1
MAAEGEVIACHTVEDWTEKLKAANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLDVV
FFKVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEKHKTVVAAA |
| Structure Information |
| PDB ID | None, but close to Chain A, Thioredoxin h1 [Arabidopsis thaliana](1XFL) with 63% match |
| Quaternary structure | Monomeric/dimeric/multimeric |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-7), and C terminus (aa 114-118) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | disulfide reductase, involved in activation of ribonucleotide reductase, modulation of transcription factors, promotion of a variety of tumors, and photosynthetic activity of plant cells |
| References for function | NA |
| E.C. number | NA |
| Location of functional site(s) | two active cysteine residues C39/42 |
| Cellular location of function | cytosol (sometimes in ER, mitochondria) |
| Comments | low molecular weight, regulated by heat shock & redox status |
| Function 2 |
| Function description | Chaperone, involved in assembly of the T7 DNA polymerase complex and the formation of fila- mentous phage |
| References for function | 19339505 |
| E.C. number | NA |
| Location of functional site(s) | Trx-fold-containing proteins interact with other proteins at the hydrophobic surface around their active site. |
| Cellular location of function | cytosol (sometimes in ER, mitochondria) |
| Comments | high molecular weight, heat shock resistance, induced by heat shock |