| General Information |
| MoonProt ID | 4028 |
| First appeared in release | 4.0 |
| Name(s) | Glyceraldehyde-3-phosphate dehydrogenase |
| UniProt ID | P20287 |
| GO terms | "GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity ; GO:0016491 oxidoreductase activity ; GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor ; GO:0050661 NADP binding ; GO:0051287 NAD binding ; GO:0006006 glucose metabolic process ; GO:0006096 glycolytic process ; GO:0019682 glyceraldehyde-3-phosphate metabolic process ; GO:0005829 cytosol ; GO:0016020 membrane." |
| Organisms for which functions have been demonstrated | Schistosoma mansoni (Blood fluke) |
| Sequence length | 338.0 |
| FASTA sequence | ">sp|P20287|G3P_SCHMA Glyceraldehyde-3-phosphate dehydrogenase OS=Schistosoma mansoni OX=6183 PE=1 SV=1
MSRAKVGINGFGRIGRLVLRAAFLKNTVDVVSVNDPFIDLEYMVYMIKRDSTHGTFPGEV
STENGKLKVNGKLISVHCERDPANIPWDKDGAEYVVESTGVFTTIDKAQAHIKNNRAKKV
IISAPSADAPMFVVGVNENSYEKSMSVVSNASCTTNCLAPLAKVIHDKFEIVEGLMTTVH
SFTATQKVVDGPSSKLWRDGRGAMQNIIPASTGAAKAVGKVIPALNGKLTGMAFRVPTPD
VSVVDLTCRLGKGASYEEIKAAVKAAASGPLKGILEYTEDEVVSSDFVGSTSSSIFDAKA
GISLNNNFVKLVSWYDNEFGYSCRVVDLITHMHKVDHA" |
| Structure Information |
| PDB ID | 7JH0 |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, glyceraldehyde 3-phosphate dehydrogenase |
| References for function | _ |
| E.C. number | EC:1.2.1.12 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds plasminogen |
| References for function | Pirovich DB, Da'dara AA, Skelly PJ. Schistosoma mansoni glyceraldehyde-3-phosphate dehydrogenase enhances formation of the blood-clot lysis protein plasmin. Biol Open. 2020 Mar 24;9(3):bio050385. doi: 10.1242/bio.050385. PMID: 32098782; PMCID: PMC7104858. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |