| General Information |
| MoonProt ID | 4031 |
| First appeared in release | 4.0 |
| Name(s) | NADH-ubiquinone oxidoreductase 1, mitochondrial |
| UniProt ID | P40215 |
| GO terms | GO:0003954 NADH dehydrogenase activity GO:0003954 NADH dehydrogenase activity GO:0003954 NADH dehydrogenase activity GO:0016491 oxidoreductase activity GO:0016491 oxidoreductase activity GO:0050136 NADH dehydrogenase (quinone) (non-electrogenic) activity GO:0120555 NADH dehydrogenase (ubiquinone) (non-electrogenic) activity GO:0015980 energy derivation by oxidation of organic compounds GO:0019655 glycolytic fermentation to ethanol GO:0019655 glycolytic fermentation to ethanol GO:0042981 regulation of apoptotic process GO:0005739 mitochondrion GO:0005739 mitochondrion GO:0005739 mitochondrion GO:0005739 mitochondrion GO:0005739 mitochondrion GO:0005739 mitochondrion GO:0005739 mitochondrion GO:0005739 mitochondrion GO:0005739 mitochondrion GO:0005739 mitochondrion GO:0005758 mitochondrial intermembrane space GO:0031966 mitochondrial membrane |
| Organisms for which functions have been demonstrated | Saccharomyces cerevisiae |
| Sequence length | 560.0 |
| FASTA sequence | ">sp|P40215|NDH1_YEAST External NADH-ubiquinone oxidoreductase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NDE1 PE=1 SV=1
MIRQSLMKTVWANSSRFSLQSKSGLVKYAKNRSFHAARNLLEDKKVILQKVAPTTGVVAK
QSFFKRTGKFTLKALLYSALAGTAYVSYSLYREANPSTQVPQSDTFPNGSKRKTLVILGS
GWGSVSLLKNLDTTLYNVVVVSPRNYFLFTPLLPSTPVGTIELKSIVEPVRTIARRSHGE
VHYYEAEAYDVDPENKTIKVKSSAKNNDYDLDLKYDYLVVGVGAQPNTFGTPGVYEYSSF
LKEISDAQEIRLKIMSSIEKAASLSPKDPERARLLSFVVVGGGPTGVEFAAELRDYVDQD
LRKWMPELSKEIKVTLVEALPNILNMFDKYLVDYAQDLFKEEKIDLRLKTMVKKVDATTI
TAKTGDGDIENIPYGVLVWATGNAPREVSKNLMTKLEEQDSRRGLLIDNKLQLLGAKGSI
FAIGDCTFHPGLFPTAQVAHQEGEYLAQYFKKAYKIDQLNWKMTHAKDDSEVARLKNQIV
KTQSQIEDFKYNHKGALAYIGSDKAIADLAVGEAKYRLAGSFTFLFWKSAYLAMCLSFRN
RVLVAMDWAKVYFLGRDSSI" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | NADH Dehydrogenase, transfers electrons from NADH to ubiquinone |
| References for function | _ |
| E.C. number | EC:1.6.5.9 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | regulator of cell death, enzyme function not needed for this function |
| References for function | Shetty S, Ganachari M, Liu MC, Azghani A, Muniyappa H, Idell S. Regulation of urokinase receptor expression by phosphoglycerate kinase is independent of its catalytic activity. Am J Physiol Lung Cell Mol Physiol. 2005 Oct;289(4):L591-8. doi: 10.1152/ajplung.00319.2004. Epub 2005 Jun 10. PMID: 15951330. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |