| General Information |
| MoonProt ID | 4033 |
| First appeared in release | 4.0 |
| Name(s) | 7-carboxy-7-deazaguanine synthase |
| UniProt ID | E8X8N4 |
| GO terms | "GO:0000287 magnesium ion binding ; GO:0003824 catalytic activity ; GO:0016829 lyase activity ; GO:0016840 carbon-nitrogen lyase activity ; GO:0046872 metal ion binding ; GO:0051536 iron-sulfur cluster binding ; GO:0051539 4 iron, 4 sulfur cluster binding ; GO:1904047 S-adenosyl-L-methionine binding ; GO:0008616 tRNA queuosine(34) biosynthetic process" |
| Organisms for which functions have been demonstrated | Salmonella typhimurium (strain 4/74) |
| Sequence length | 223.0 |
| FASTA sequence | ">tr|E8X8N4|E8X8N4_SALT4 7-carboxy-7-deazaguanine synthase OS=Salmonella typhimurium (strain 4/74) OX=909946 GN=queE PE=3 SV=1
MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPVGCAWCDTKHTWDKLSDREVSLFSILAK
TKESDKWGAASSEDLLAVINRQGYTARHVVITGGEPCIHDLMPLTDLLEKSGFSCQIETS
GTHEVRCTPNTWVTVSPKVNMRGGYDVLSQALERANEIKHPVGRVRDIEALDELLATLSD
DKPRVIALQPISQKEDATRLCIETCIARNWRLSMQTHKYLNIA" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, 7-carboxy-7-deazaguanine or CDG synthase, catalyzes the conversion of the substrate CPH4 (6-carboxy-5,6,7,8-tetrahydropterin) to CDG (7-carboxy-7-deazaguanine), in pathway for queuosine (Q) tRNA modification |
| References for function | _ |
| E.C. number | EC:4.3.99.3 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds to cell division septal site, blocking division and resulting in filamentous growth |
| References for function | Adeleye SA, Yadavalli SS. Queuosine biosynthetic enzyme, QueE moonlights as a cell division regulator. PLoS Genet. 2024 May 20;20(5):e1011287. doi: 10.1371/journal.pgen.1011287. PMID: 38768229; PMCID: PMC11142719. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | Cell division septum / midcell |
| Comments | |