| General Information |
| MoonProt ID | 4036 |
| First appeared in release | 4.0 |
| Name(s) | malic enzyme YtsJ |
| UniProt ID | O34962 |
| GO terms | GO:0004470 malic enzyme activity ; GO:0004473 malate dehydrogenase (decarboxylating) (NADP+) activity ; GO:0004473 malate dehydrogenase (decarboxylating) (NADP+) activity ; GO:0005515 protein binding ; GO:0008948 oxaloacetate decarboxylase activity ; GO:0016491 oxidoreductase activity ; GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor ; GO:0016829 lyase activity ; GO:0043883 malolactic enzyme activity ; GO:0046872 metal ion binding ; GO:0051287 NAD binding |
| Organisms for which functions have been demonstrated | Bacillus subtilis (strain 168) |
| Sequence length | 410.0 |
| FASTA sequence | ">sp|O34962|MAO4_BACSU Bifunctional malic/malolactic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=ytsJ PE=1 SV=1
MSLREEALHLHKVNQGKLESKSKVEVRNAKDLSLAYSPGVAEPCKDIHEDINKVYDYTMK
GNMVAVVTDGTAVLGLGNIGPEAALPVMEGKAVLFKSFAGVDAFPIALNTNDVDKIVETV
KLLEPTFGGVNLEDIAAPNCFIIEERLKKETNIPVFHDDQHGTAIVTVAGLVNALKLSGK
SMSSIKVVANGAGAAGIAIIKLLHHYGVRDIVMCDSKGAIYEGRPNGMNDVKNEVAKFTN
QDRKDGSLKDVIVDADVFIGVSVAGALTKEMVQSMAKDPIIFAMANPNPEIMPEDAREAG
ASVVGTGRSDFPNQVNNVLAFPGIFRGALDVRATHINEEMKIAAVEAIASLVSEDELSAD
YVIPAPFDKRVAPAVAKAVAKAAMETGVARITVDPEEVAEKTRKLTIIGE" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, malic enzyme, NADP-dependent malate decarboxylation |
| References for function | _ |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | malolytic activity |
| References for function | Hörl M, Fuhrer T, Zamboni N. 2021. Bifunctional Malic/Malolactic Enzyme Provides a Novel Mechanism for NADPH-Balancing in Bacillus subtilis. mBio 12:10.1128/mbio.03438-20. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |