| General Information |
| MoonProt ID | 4040 |
| First appeared in release | 4.0 |
| Name(s) | threonine synthase |
| UniProt ID | L7EF31 |
| GO terms | GO:0003941 L-serine ammonia-lyase activity , GO:0004794 threonine deaminase activity , GO:0004795 threonine synthase activity , GO:0016829 lyase activity , GO:0030170 pyridoxal phosphate binding , GO:0006520 amino acid metabolic process , GO:0006565 L-serine catabolic process , GO:0006567 L-threonine catabolic process , GO:0008652 amino acid biosynthetic process , GO:0009088 threonine biosynthetic process , GO:0009097 isoleucine biosynthetic process , GO:1901605 alpha-amino acid metabolic process |
| Organisms for which functions have been demonstrated | Microcystis aeruginosa TAIHU98 |
| Sequence length | 369.0 |
| FASTA sequence | ">tr|L7EF31|L7EF31_MICAE Threonine synthase OS=Microcystis aeruginosa TAIHU98 OX=1134457 GN=thrC PE=3 SV=1
MTIISRSIPQSPTKSSSIGGWRGLIEEYRQFLPVSSKTPVITLLEGNTPLIPAPYLSAQI
GRDVKVFVKYDGLNPTGSFKDRGMTMAISKAKEEGAKAVICASTGNTSAAAAAYARRAGM
RAFVIIPDGYVALGKLAQALLYGAEVIAINGNFDDALKIVRQLSENYPVTLVNSVNPYRL
EGQKTAAFEIVDVLGNAPDWLCIPVGNAGNISAYWMGFCQYHQIGKCDRLPKMMGFQASG
AAPFISKQPVDHPETLATAIRIGNPANWEKAWAASHASQGQFHAVSDEEILAAYRILGGQ
EGVFCEPASAASVAGLLKVHQQVPDGATVVCVLTGNGLKDPDSAVKHSNNQLKSGIAPEL
TQVAQIMGF" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, threonine synthase |
| References for function | _ |
| E.C. number | 4.2.3.1 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | enzyme, threonine deaminase |
| References for function | Kim W, Son Y, Park Y, Kim M, Lee R, Kim KES, Shin SJ, Park W. Moonlighting activity of threonine synthase in cyanobacterial cell death. mSystems. 2025 Jun 17;10(6):e0031025. doi: 10.1128/msystems.00310-25. Epub 2025 May 5. PMID: 40323092; PMCID: PMC12172450. |
| E.C. number | 4.3.1.19 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |