| General Information |
| MoonProt ID | 4043 |
| First appeared in release | 4.0 |
| Name(s) | phosphomannomutase 1 |
| UniProt ID | Q92871 |
| GO terms | "GO:1990830 cellular response to leukemia inhibitory factor
GO:0004615 phosphomannomutase activity
GO:0005515 protein binding
GO:0016853 isomerase activity
GO:0046872 metal ion binding
GO:0006013 mannose metabolic process
GO:0006487 protein N-linked glycosylation
GO:0009298 GDP-mannose biosynthetic process
GO:1901293 nucleoside phosphate biosynthetic process
GO:0005829 cytosol
GO:0005737 cytoplasm
GO:0043025 neuronal cell body" |
| Organisms for which functions have been demonstrated | Homo sapiens |
| Sequence length | 262.0 |
| FASTA sequence | ">sp|Q92871|PMM1_HUMAN Phosphomannomutase 1 OS=Homo sapiens OX=9606 GN=PMM1 PE=1 SV=2
MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIA
EQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLR
LPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLR
FSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSV
VSPQDTVQRCREIFFPETAHEA" |
| Structure Information |
| PDB ID | 2FUC, 2FUE |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, catalyzes the interconversion of hexose 6-phosphates and hexose 1-phosphates |
| References for function | Ji T, Zhang C, Zheng L, Dunaway-Mariano D, Allen KN. Structural Basis of the Molecular Switch between Phosphatase and Mutase Functions of Human Phosphomannomutase 1 under Ischemic Conditions. Biochemistry. 2018 Jun 26;57(25):3480-3492. doi: 10.1021/acs.biochem.8b00223. Epub 2018 May 11. PMID: 29695157; PMCID: PMC10251306. |
| E.C. number | 5.4.2.8 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | enzyme, phosphohydrolase, converts glucose 1,6-bisphosphate to glucose 6-phosphate |
| References for function | Ji T, Zhang C, Zheng L, Dunaway-Mariano D, Allen KN. Structural Basis of the Molecular Switch between Phosphatase and Mutase Functions of Human Phosphomannomutase 1 under Ischemic Conditions. Biochemistry. 2018 Jun 26;57(25):3480-3492. doi: 10.1021/acs.biochem.8b00223. Epub 2018 May 11. PMID: 29695157; PMCID: PMC10251306. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |