| General Information |
| MoonProt ID | 4045 |
| First appeared in release | 4.0 |
| Name(s) | Triosephosphate isomerase |
| UniProt ID | Q6FRI3 |
| GO terms | "GO:0004807 triose-phosphate isomerase activity
GO:0016853 isomerase activity
GO:0006094 gluconeogenesis
GO:0006096 glycolytic process
GO:0019563 glycerol catabolic process
GO:0046166 glyceraldehyde-3-phosphate biosynthetic process
GO:0061621 canonical glycolysis
GO:0005829 cytosol
GO:0009986 cell surface" |
| Organisms for which functions have been demonstrated | Candida glabrata |
| Sequence length | 248 amino acids |
| FASTA sequence | ">sp|Q6FRI3|TPIS_CANGA Triosephosphate isomerase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=TPI1 PE=3 SV=1
MARTFFVGGNFKLNGTKKSIKEIVDRLNTASLPENVEVVICPPATYLDYTVSLVSKKQVTVGGQNTYTKASGAYTGENSVDQLKDVGAKWVILGHSERRTYFHEDDKIVAEKTKFALDQGLGVILCIGETLEEKKAGVTLKVVERQLDAVIAEVKDWTNVVIAYEPVWAIGTGLAATAEDAQDIHHSIRSYLAEKLGKDTAEKTRILYGGSANGANAGTFKDKADVDGFLVGGASLKPEFVDIINSRN" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Enzyme, catalyzes interconversion of dihydroxyacetone phosphate to glyceraldehyde-3-phosphate, Carbohydrate biosynthesis; gluconeogenesis. Carbohydrate degradation; glycolysis; D-glyceraldehyde 3-phosphate from glycerone phosphate |
| References for function | _ |
| E.C. number | 5.3.1.1 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | Binds to proteins in host extracellular matrix, vitronectin, fibronectin, laminin, collagen, elastase |
| References for function | Satala D, Satala G, Zawrotniak M, Kozik A. Candida albicans and Candida glabrata triosephosphate isomerase - a moonlighting protein that can be exposed on the candidal cell surface and bind to human extracellular matrix proteins. BMC Microbiol. 2021 Jul 1;21(1):199. doi: 10.1186/s12866-021-02235-w. PMID: 34210257; PMCID: PMC8252264. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |