| General Information |
| MoonProt ID | 4054 |
| First appeared in release | 4.0 |
| Name(s) | Mechanosensitive ion channel protein MscS |
| UniProt ID | Q5SHL5 |
| GO terms | GO:0005886 plasma membrane, GO:0016020 membrane, GO:0008381 mechanosensitive monoatomic ion channel activity, GO:0034220 monoatomic ion transmembrane transport, GO:0055085 transmembrane transport |
| Organisms for which functions have been demonstrated | Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) |
| Sequence length | 355.0 |
| FASTA sequence | ">tr|Q5SHL5|Q5SHL5_THET8 Mechanosensitive ion channel protein MscS OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=TTHA1715 PE=3 SV=1
MLAALHIALTLAAVVLLGRLGARLLGRLAALTPSTRDDAFFRLLGYAWWGVVAVAGASYL
SHALSLPYEPLATWGRSLVAWLGGKGVAGGAVLLATWTAYRLVPLLLRSLPLPETEGELT
RQAVRAKTLRNVSESALKVAVVTVGGLLFLSNLGLNVTALLAGAGVAGLALSFAAQNLIR
DFINGFFILLEDQYGVGDIVKVGDLAGVVEKFNLRLTVLRDLEGKAHFIPNSQIQQVTVF
TQEWSRAVVDVGVAYKEDVDRVLAIFRDEAERFFQDPEWQDKLTNPPEVLGVENLADSAV
VIRTLFGTKPAQQWAVAREFRRRIKKRLDQEGVEIPFPHRTLYFGEPLRVVKETP" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | 4 |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | mechanosensitive channel |
| References for function | _ |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell membrane |
| Comments | |
| Function 2 |
| Function description | copper channel |
| References for function | Ghnamah Y, Palmer CD, Livnat-Levanon N, Grupper M, Rosenzweig AC, Lewinson O. Prokaryotic mechanosensitive channels mediate copper influx. Protein Sci. 2025 Jul;34(7):e70205. doi: 10.1002/pro.70205. PMID: 40563205; PMCID: PMC12198049. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell membrane |
| Comments | |