| General Information |
| MoonProt ID | 4058 |
| First appeared in release | 4.0 |
| Name(s) | Craniofacial development protein 1 - Yeti |
| UniProt ID | Q8SXI2 |
| GO terms | GO:0005634 nucleus, GO:0005700 polytene chromosome, GO:0007076 mitotic chromosome condensation, GO:0010032 meiotic chromosome condensation, GO:0019894 kinesin binding, GO:0051276 chromosome organization |
| Organisms for which functions have been demonstrated | Drosophila melanogaster (fruit fly) |
| Sequence length | 241.0 |
| FASTA sequence | ">tr|Q8SXI2|Q8SXI2_DROME Craniofacial development protein 1 OS=Drosophila melanogaster OX=7227 GN=Yeti PE=1 SV=1
MNSQKEYVSDCETDDDYYVDLLTSGKGSDKSESDVSDKSENYPGLKSKHTAKALRKTRHC
DGDNREYRSKECDDLHSEEESEKSRSDALWADFLGDIDTKSVINQKTDYTEGNAASATNT
NTHETCNKYDKNDTAIIKTAQQYDSKRTTLSVSTLGKIKRSSAEKSIGTMINKFEKKKKL
TVLERSQLDWKIFKQDEGIDELLCSHNKGKDGYLDRQDFLERTDLRQFEMEKKLRLSRRP
Y" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | component of DOM/TIP60 chromatin remodeling complex |
| References for function | _ |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |
| Function 2 |
| Function description | localize along the microtubular structure of the spindle in the meiotic apparatus during meiosis |
| References for function | Prozzillo, Y., Fattorini, G., Ferreri, D., Leo, M., Dimitri, P., & Messina, G. (2023). Knockdown of DOM/Tip60 Complex Subunits Impairs Male Meiosis of Drosophila melanogaster. Cells, 12(10), 1348. https://doi.org/10.3390/cells12101348 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | localize along the microtubular structure of the spindle in the meiotic apparatus during meiosis |
| Comments | |