| General Information |
| MoonProt ID | 4061 |
| First appeared in release | 4.0 |
| Name(s) | NuA4 complex subunit EAF3 homolog - MRG15 |
| UniProt ID | Q9Y0I1 |
| GO terms | GO:0000123 histone acetyltransferase complex, GO:0000812 Swr1 complex, GO:0003682 chromatin binding, GO:0005515 protein binding, GO:0005634 nucleus, GO:0005694 chromosome, GO:0006281 DNA repair, GO:0006325 chromatin organization, GO:0006338 chromatin remodeling, GO:0006355 regulation of DNA-templated transcription, GO:0006974 DNA damage response, GO:0010628 positive regulation of gene expression, GO:0030234 enzyme regulator activity, GO:0031507 heterochromatin formation, GO:0035097 histone methyltransferase complex, GO:0035267 NuA4 histone acetyltransferase complex, GO:0045893 positive regulation of DNA-templated transcription, GO:0051276 chromosome organization, GO:0051304 chromosome separation, GO:0140861 DNA repair-dependent chromatin remodeling, GO:1990889 histone H4K20me3 reader activity |
| Organisms for which functions have been demonstrated | Drosophila melanogaster (fruit fly) |
| Sequence length | 424.0 |
| FASTA sequence | ">sp|Q9Y0I1|EAF3_DROME NuA4 complex subunit EAF3 homolog OS=Drosophila melanogaster OX=7227 GN=MRG15 PE=1 SV=1
MGEVKPAKVENYSTGTDANTLFVDGERVLCFHGPLIYEAKVLKTKPDATPVEYYIHYAGW
SKNWDEWVPENRVLKYNDDNVKRRQELARQCGERSKKDNKKGSAKAKKMEQMRNESRAST
PSKDSNTSQSTASSTPTTSAGPGSKSEAGSTGTTTTNSTANSTTSRAHRKSTQSTPSTAR
PGTPSDKKEDPAAAETTEEEGPVAPKKKRMSEQRPSLTGSDVAEKPLPPTTTPSTPTTEP
APCVESEEAYAAKVEVKIKIPDELKHYLTDDWYAVVREHKLLELPAKVTVQQISEQYLAH
KKSVKSTSASKEVAINDVLDGIVEYFNVMLGSQLLYKFERTQYADVMQKHPDTPLSELYG
SFHLLRLFVRLGSMLSYSALDQQSMQNLLTHVQDFLKFLVKNSSIFFSMSNFINVDPEYV
RNAQ" |
| Structure Information |
| PDB ID | 2LRQ |
| Quaternary structure | Component of the Tip60 chromatin-remodeling complex which contains the catalytic subunit Tip60 and the subunits Domino, Tra1, Brd8, E(Pc), DMAP1, Pontin, Reptin, Ing3, Act87E, BAP55, Mrg15, MrgBP, Gas41 and YL-1. |
| SCOP | "80616312LRQ A:2-85
80616322LRQ A:2-85" |
| CATH | 2lrqA00 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | component of DOM/TIP60 chromatin remodeling complex |
| References for function | _ |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |
| Function 2 |
| Function description | localizes to centrosome during meiosis |
| References for function | Prozzillo, Y., Fattorini, G., Ferreri, D., Leo, M., Dimitri, P., & Messina, G. (2023). Knockdown of DOM/Tip60 Complex Subunits Impairs Male Meiosis of Drosophila melanogaster. Cells, 12(10), 1348. https://doi.org/10.3390/cells12101348 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | localizes to centrosome during meiosis |
| Comments | |