| General Information |
| MoonProt ID | 4065 |
| First appeared in release | 4.0 |
| Name(s) | Splicing factor 3A subunit 2 |
| UniProt ID | Q62203 |
| GO terms | "GO:0000375 RNA splicing, via transesterification reactions
GO:0000398 mRNA splicing, via spliceosome
GO:0003676 nucleic acid binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0010976 positive regulation of neuron projection development
GO:1903241 U2-type prespliceosome assembly
GO:1903241 U2-type prespliceosome assembly
GO:0005634 nucleus
GO:0005634 nucleus
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0016607 nuclear speck
GO:0005681 spliceosomal complex
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0005686 U2 snRNP
GO:0005686 U2 snRNP
GO:0005686 U2 snRNP
GO:0071004 U2-type prespliceosome
GO:0071005 U2-type precatalytic spliceosome
GO:0071005 U2-type precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome" |
| Organisms for which functions have been demonstrated | Mus musculus (Mouse) |
| Sequence length | 475.0 |
| FASTA sequence | ">sp|Q62203|SF3A2_MOUSE Splicing factor 3A subunit 2 OS=Mus musculus OX=10090 GN=Sf3a2 PE=1 SV=2
MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL
TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEQVKVEVKKFVKIGRPGYKVT
KQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIA
FKVPSREIDKAEGKFFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPDA
LPPPPPGGLPLPPMPPTGPAPSGPPGPPQMPPPAPGVHPPAPVVHPPTSGVHPPAPGVHP
PAPVVHPPTSGVHPPAPGVHPPTPGVHPPAPGVHPPAPGVHPPAPGVHPPTPGVHPPAPG
VHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPPAPAVHPQAPGVHPPAPGIHPQAPGVHP
QPPPGVHPAAPGVHPQPPGVHPSNPGVHPAPMPPMLRPPLPSDGPGNMPPPPPGN" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | Component of the 17S U2 SnRNP complex, a ribonucleoprotein complex that contains small nuclear RNA (snRNA) U2 and a number of specific proteins. |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | component of the pre-mRNA splicing complex |
| References for function | _ |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |
| Function 2 |
| Function description | binds microtubules, interacts with gamma-tubulin ring complex and recruits it to microtubule nucleation sites. |
| References for function | Takenaka K, Nakagawa H, Miyamoto S, Miki H. The pre-mRNA-splicing factor SF3a66 functions as a microtubule-binding and -bundling protein. Biochem J. 2004 Aug 15;382(Pt 1):223-30. doi: 10.1042/BJ20040521. PMID: 15142036; PMCID: PMC1133934. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |