| General Information |
| MoonProt ID | 4084 |
| First appeared in release | 4.0 |
| Name(s) | Actin-like protein 6A |
| UniProt ID | O96019 |
| GO terms | "GO:0001825 blastocyst formation
GO:0006338 chromatin remodeling
GO:0031492 nucleosomal DNA binding
GO:0003682 chromatin binding
GO:0003682 chromatin binding
GO:0003682 chromatin binding
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0000723 telomere maintenance
GO:0000723 telomere maintenance
GO:0003407 neural retina development
GO:0006275 regulation of DNA replication
GO:0006281 DNA repair
GO:0006282 regulation of DNA repair
GO:0006282 regulation of DNA repair
GO:0006310 DNA recombination
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006338 chromatin remodeling
GO:0006338 chromatin remodeling
GO:0006338 chromatin remodeling
GO:0006338 chromatin remodeling
GO:0006338 chromatin remodeling
GO:0006338 chromatin remodeling
GO:0006338 chromatin remodeling
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006974 DNA damage response
GO:0007165 signal transduction
GO:0007399 nervous system development
GO:0007399 nervous system development
GO:0008284 positive regulation of cell population proliferation
GO:0021510 spinal cord development
GO:0030071 regulation of mitotic metaphase/anaphase transition
GO:0030071 regulation of mitotic metaphase/anaphase transition
GO:0033044 regulation of chromosome organization
GO:0033044 regulation of chromosome organization
GO:0042981 regulation of apoptotic process
GO:0045582 positive regulation of T cell differentiation
GO:0045596 negative regulation of cell differentiation
GO:0045597 positive regulation of cell differentiation
GO:0045663 positive regulation of myoblast differentiation
GO:0045663 positive regulation of myoblast differentiation
GO:0045739 positive regulation of DNA repair
GO:0045739 positive regulation of DNA repair
GO:0045893 positive regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0045995 regulation of embryonic development
GO:0045995 regulation of embryonic development
GO:0048731 system development
GO:0051726 regulation of cell cycle
GO:0051726 regulation of cell cycle
GO:0060382 regulation of DNA strand elongation
GO:0070316 regulation of G0 to G1 transition
GO:1902459 positive regulation of stem cell population maintenance
GO:1902459 positive regulation of stem cell population maintenance
GO:1904507 positive regulation of telomere maintenance in response to DNA damage
GO:1904507 positive regulation of telomere maintenance in response to DNA damage
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:2000045 regulation of G1/S transition of mitotic cell cycle
GO:2000779 regulation of double-strand break repair
GO:2000781 positive regulation of double-strand break repair
GO:2000781 positive regulation of double-strand break repair
GO:2000819 regulation of nucleotide-excision repair
GO:0000776 kinetochore
GO:0000785 chromatin
GO:0000785 chromatin
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005886 plasma membrane
GO:0016363 nuclear matrix
GO:0000786 nucleosome
GO:0000786 nucleosome
GO:0016514 SWI/SNF complex
GO:0016514 SWI/SNF complex
GO:0016514 SWI/SNF complex
GO:0016514 SWI/SNF complex
GO:0016514 SWI/SNF complex
GO:0016514 SWI/SNF complex
GO:0016514 SWI/SNF complex
GO:0016586 RSC-type complex
GO:0031011 Ino80 complex
GO:0031011 Ino80 complex
GO:0031011 Ino80 complex
GO:0032991 protein-containing complex
GO:0035060 brahma complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:0071564 npBAF complex
GO:0071564 npBAF complex
GO:0071564 npBAF complex
GO:0071564 npBAF complex
GO:0140288 GBAF complex" |
| Organisms for which functions have been demonstrated | Homo sapiens (Human) |
| Sequence length | 429.0 |
| FASTA sequence | ">sp|O96019|ACL6A_HUMAN Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A PE=1 SV=1
MSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDK
GKQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPV
LMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAI
PVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRK
EKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAE
RLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSF
TDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGG
KQCVERKCP" |
| Structure Information |
| PDB ID | 6LTJ |
| Quaternary structure | component of a multiprotein complex |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | component of SRCAP and p400/Tip60 chromatin remodeling complexes |
| References for function | _ |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |
| Function 2 |
| Function description | localizes to mitotic spindle and midbody during cell division |
| References for function | Messina G, Prozzillo Y, Monache FD, Santopietro MV, Dimitri P. Evolutionary conserved relocation of chromatin remodeling complexes to the mitotic apparatus. BMC Biol. 2022 Aug 3;20(1):172. doi: 10.1186/s12915-022-01365-5. PMID: 35922843; PMCID: PMC9351137. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | localizes to mitotic spindle and midbody during cell division |
| Comments | |