| General Information |
| MoonProt ID | 4086 |
| First appeared in release | 4.0 |
| Name(s) | Craniofacial development protein 1 |
| UniProt ID | Q9UEE9 |
| GO terms | "GO:0007155 cell adhesion
GO:0008360 regulation of cell shape
GO:0042127 regulation of cell population proliferation
GO:2000270 biological_process negative regulation of fibroblast apoptotic process
GO:0006338 chromatin remodeling
GO:0000776 kinetochore
GO:0000812 Swr1 complex" |
| Organisms for which functions have been demonstrated | Homo sapiens (Human) |
| Sequence length | 299.0 |
| FASTA sequence | ">sp|Q9UEE9|CFDP1_HUMAN Craniofacial development protein 1 OS=Homo sapiens OX=9606 GN=CFDP1 PE=1 SV=1
MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPA
RKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLND
VGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTK
EVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMST
LEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | _ |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Component of SRCAP chromatin remodeling complex |
| References for function | _ |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |
| Function 2 |
| Function description | localizes to mitotic spindle and midbody during cell division |
| References for function | Messina G, Prozzillo Y, Monache FD, Santopietro MV, Dimitri P. Evolutionary conserved relocation of chromatin remodeling complexes to the mitotic apparatus. BMC Biol. 2022 Aug 3;20(1):172. doi: 10.1186/s12915-022-01365-5. PMID: 35922843; PMCID: PMC9351137. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | localizes to mitotic spindle and midbody during cell division |
| Comments | |