| General Information |
| MoonProt ID | 4091 |
| First appeared in release | 4.0 |
| Name(s) | YEATS domain-containing protein 4 |
| UniProt ID | O95619 |
| GO terms | "GO:0010467 gene expression
GO:0005200 structural constituent of cytoskeleton
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0042393 histone binding
GO:0140044 histone H3K18ac reader activity
GO:0140119 histone H3K27ac reader activity
GO:0000278 mitotic cell cycle
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0007010 cytoskeleton organization
GO:0042981 regulation of apoptotic process
GO:0045893 positive regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0051726 regulation of cell cycle
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:2000779 regulation of double-strand break repair
GO:0005634 nucleus
GO:0005634 nucleus
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0005654 nucleoplasm
GO:0016363 nuclear matrix
GO:0000786 nucleosome
GO:0000786 nucleosome
GO:0035267 NuA4 histone acetyltransferase complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:0035267 NuA4 histone acetyltransferase complex" |
| Organisms for which functions have been demonstrated | Homo sapiens (Human) |
| Sequence length | 227.0 |
| FASTA sequence | ">sp|O95619|YETS4_HUMAN YEATS domain-containing protein 4 OS=Homo sapiens OX=9606 GN=YEATS4 PE=1 SV=1
MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMS
AYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKL
FQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTR
EKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI" |
| Structure Information |
| PDB ID | 5R68 |
| Quaternary structure | subunit of a multiprotein complex |
| SCOP | "No SCOP2 classification is available for 5R68 A explicitly. This entry is represented by following domains ...
80537465Y8V A
80537485Y8V A
No SCOP2 classification is available for 5R68 B explicitly. This entry is represented by following domains ...
80537465Y8V A
80537485Y8V A" |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | component of SRCAP and p400/Tip60 chromatin remodeling complexes |
| References for function | _ |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |
| Function 2 |
| Function description | localizes to mitotic spindle and midbody during cell division |
| References for function | Messina G, Prozzillo Y, Monache FD, Santopietro MV, Dimitri P. Evolutionary conserved relocation of chromatin remodeling complexes to the mitotic apparatus. BMC Biol. 2022 Aug 3;20(1):172. doi: 10.1186/s12915-022-01365-5. PMID: 35922843; PMCID: PMC9351137. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | localizes to mitotic spindle and midbody during cell division |
| Comments | |