| General Information |
| MoonProt ID | 410 |
| First appeared in release | 3.0 |
| Name(s) | Cyclic AMP-dependent transcription factor ATF-5; cAMP-dependent transcription factor ATF-5; Activating transcription factor 5; Transcription factor ATFx; gene: ATF5 |
| UniProt ID | Q9Y2D1 |
| GO terms | GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0006357 regulation of transcription by RNA polymerase II
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0005634 nucleus
GO:0015631 tubulin binding
GO:0008285 negative regulation of cell population proliferation
GO:0045892 negative regulation of transcription, DNA-templated
GO:0045893 positive regulation of transcription, DNA-templated
GO:0003682 chromatin binding
GO:0045893 positive regulation of transcription, DNA-templated
GO:0003700 DNA-binding transcription factor activity
GO:0005813 centrosome
GO:0046605 regulation of centrosome cycle
GO:0005634 nucleus
GO:1902750 negative regulation of cell cycle G2/M phase transition
GO:0006355 regulation of transcription, DNA-templated
GO:0021930 cerebellar granule cell precursor proliferation
GO:0000976 transcription regulatory region sequence-specific DNA binding
GO:0043565 sequence-specific DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0045893 positive regulation of transcription, DNA-templated
GO:0043066 negative regulation of apoptotic process
GO:0045444 fat cell differentiation
GO:0005515 protein binding
GO:0019900 kinase binding
GO:0003700 DNA-binding transcription factor activity
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006355 regulation of transcription, DNA-templated
GO:0005634 nucleus
GO:0003677 DNA binding
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0006357 regulation of transcription by RNA polymerase II
GO:0005515 protein binding
GO:0045444 fat cell differentiation
GO:0043565 sequence-specific DNA binding
GO:0043066 negative regulation of apoptotic process
GO:0021988 olfactory lobe development
GO:0021930 cerebellar granule cell precursor proliferation
GO:0021891 olfactory bulb interneuron development
GO:0021889 olfactory bulb interneuron differentiation
GO:0009791 post-embryonic development
GO:0006357 regulation of transcription by RNA polymerase II
GO:0003682 chromatin binding
GO:0000976 transcription regulatory region sequence specific DNA binding
GO:0035264 multicellular organism growth
GO:0010468 regulation of gene expression
GO:0007623 circadian rhythm
GO:0005667 transcription regulator complex
GO:0005634 nucleus
GO:0005815 microtubule organizing center
GO:0005737 cytoplasm C
GO:0005654 nucleoplasm
GO:0005829 cytosol
|
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal) |
| Sequence length | 282 amino acids |
| FASTA sequence | >sp|Q9Y2D1|ATF5_HUMAN Cyclic AMP-dependent transcription factor ATF-5 OS=Homo sapiens OX=9606 GN=ATF5 PE=1 SV=4
MSLLATLGLELDRALLPASGLGWLVDYGKLPPAPAPLAPYEVLGGALEGGLPVGGEPLAG
DGFSDWMTERVDFTALLPLEPPLPPGTLPQPSPTPPDLEAMASLLKKELEQMEDFFLDAP
PLPPPSPPPLPPPPLPPAPSLPLSLPSFDLPQPPVLDTLDLLAIYCRNEAGQEEVGMPPL
PPPQQPPPPSPPQPSRLAPYPHPATTRGDRKQKKRDQNKSAALRYRQRKRAEGEALEGEC
QGLEARNRELKERAESVEREIQYVKDLLIEVYKARSQRTRSC |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
moonID_410_uniID_Q9Y2D1 is 282 residues long, with 261 residues (92.55%) predicted as disordered.The protein has 0 short (< 30 residues) disorder segments and 1 long (>= 30 residues) disorder segment.
Segment 1 - Long (>= 30 residues) disordered segment Segment is located between positions 22 and 282 in the sequence. The segment is 261 residues long (92.55 % of the total sequence length). |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | accumulation at the centrosomes from G1 through anaphase and dissociation during late telophase; interacts with centrosomal proteins, including gamma-tubulin and pericentrin (PCNT), |
| References for function | 26213385 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | centrosomes; nucleus |
| Comments | member of the ATF/CREB family of TFs, specifically enriched in a cylindrical structure that encircles the proximal end of the mother centriole; association with centrosomes is regulated by SUMOylation; |
| Function 2 |
| Function description | centriolar fragmentation and formation of multipolar spindles during downregulation of ATF5 (RNAi-mediated) |
| References for function | 26213385 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | centrosome |
| Comments | NA |