| General Information |
| MoonProt ID | 4103 |
| First appeared in release | 4.0 |
| Name(s) | Wall-associated receptor kinase-like 10 |
| UniProt ID | Q8VYA3 |
| GO terms | "GO:0006952 defense response
GO:0009617 response to bacterium
GO:0009620 response to fungus
GO:0009751 response to salicylic acid
GO:0000166 nucleotide binding
GO:0004383 guanylate cyclase activity
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005509 calcium ion binding
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016740 transferase activity
GO:0030247 polysaccharide binding
GO:0106310 protein serine kinase activity
GO:0006182 cGMP biosynthetic process
GO:0006952 defense response
GO:0007166 cell surface receptor signaling pathway
GO:0007166 cell surface receptor signaling pathway
GO:0005886 plasma membrane
GO:0016020 membrane" |
| Organisms for which functions have been demonstrated | Arabidopsis thaliana (Mouse-ear cress) |
| Sequence length | 769.0 |
| FASTA sequence | ">sp|Q8VYA3|WAKLJ_ARATH Wall-associated receptor kinase-like 10 OS=Arabidopsis thaliana OX=3702 GN=WAKL10 PE=2 SV=1
MSSNCSCSLLSLFSLLLIIDLTVASSCPKTCGGIDIPYPFGIGTGCYLEKWYEIICVNNS
VPFLSIINREVVSISFSDMYRRFFNVGYGSIRIRNPIASKGCSSGGQEFGSLLNMTGYPF
YLGDNNMLIAVGCNNTASLTNVEPSIVGCESTCSTNQDIPINDYLGVLYCNARYGDSEYC
KNISIMNDTSCNGIGCCKASLPARYQQIIGVEIDDSNTESKGCKVAFITDEEYFLSNGSD
PERLHANGYDTVDLRWFIHTANHSFIGSLGCKSIDEYTILRRDNREYGIGCLCDYNSTTT
GYATCSCASGFEGNPYIPGECKDINECVRGIDGNPVCTAGKCVNLLGGYTCEYTNHRPLV
IGLSTSFSTLVFIGGIYWLYKFIRRQRRLNQKKKFFKRNGGLLLQQQLTTTEGNVDSTRV
FNSRELEKATENFSLTRILGEGGQGTVYKGMLVDGRIVAVKKSKVVDEDKLEEFINEVVI
LSQINHRNIVKLLGCCLETDVPILVYEFIPNGNLFEHLHDDSDDYTMTTWEVRLRIAVDI
AGALSYLHSAASSPIYHRDIKSTNIMLDEKHRAKVSDFGTSRTVTVDHTHLTTVVSGTVG
YMDPEYFQSSQFTDKSDVYSFGVVLAELITGEKSVSFLRSQEYRTLATYFTLAMKENRLS
DIIDARIRDGCKLNQVTAAAKIARKCLNMKGRKRPSMRQVSMELEKIRSYSEDMQPYEYA
SENEEEKKETLVDVNVESRNYVSVTAASSQYSIATTSSSRSDVEPLFPR" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | 1 |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, kinase |
| References for function | "Meier S, Ruzvidzo O, Morse M, Donaldson L, Kwezi L, Gehring C.
The Arabidopsis Wall Associated Kinase-Like 10 Gene Encodes a Functional Guanylyl Cyclase and Is Co-Expressed with Pathogen Defense Related Genes.
PLoS One. 2010 Jan 26; 5(1): e8904. PMID: 20126659." |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | transmembrane, with kinase domain in cytoplasmic domain |
| Comments | |
| Function 2 |
| Function description | enzyme, guanydylate cyclase |
| References for function | "Meier S, Ruzvidzo O, Morse M, Donaldson L, Kwezi L, Gehring C.
The Arabidopsis Wall Associated Kinase-Like 10 Gene Encodes a Functional Guanylyl Cyclase and Is Co-Expressed with Pathogen Defense Related Genes.
PLoS One. 2010 Jan 26; 5(1): e8904. PMID: 20126659." |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | transmembrane, with GC active site in the cytoplasmic domain |
| Comments | |