| General Information |
| MoonProt ID | 4111 |
| First appeared in release | 4.0 |
| Name(s) | Glyceraldehyde-3-phosphate dehydrogenase |
| UniProt ID | A0AAJ5NRV3 |
| GO terms | "GO:0000166 nucleotide binding
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0050661 NADP binding
GO:0051287 NAD binding
GO:0006006 glucose metabolic process" |
| Organisms for which functions have been demonstrated | Mesomycoplasma hyorhinis (Mycoplasma hyorhinis) |
| Sequence length | 333.0 |
| FASTA sequence | ">tr|A0AAJ5NRV3|A0AAJ5NRV3_MESHY Glyceraldehyde-3-phosphate dehydrogenase OS=Mesomycoplasma hyorhinis OX=2100 GN=gap PE=3 SV=1
MKKIAINGFGRIGRLILRRILELNTKELEVVAINDLTSAPVLKHLFKYDSAHGTFQGTVE
AVGDDKLVVNGHEIKIFAQRDPENLPWGELGVDLVVESTGFFASKEGSEKHLKAGAKKVL
VSAPAGNDVKTIVYNVNHDTITSEDKILSAASCTTNALAPLVHFLDKKFGISHGFMTTVH
AYTADQRLQDSPHKDLRRARAAAYNIVPSSTGAAKAIGLVVPSLTGKLDGIAIRVPVITG
SFVDLSVELKSNPSVEEVNAEMKRVQNESFQYNEDQVVSSDIVNNTHGSIFDATLTKFID
VNGKRLYKLYAWYDNESSFVAQYVRVALHFAKK" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | 0 |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, glyceraldehyde 3-phosphate dehydrogenase, catalyzes the reversible oxidative phosphorylation of glyceraldehyde 3-phosphate to 1,3-bisphosphate coupled with reduction of NAD+ to NADH |
| References for function | _ |
| E.C. number | EC:1.2.1.- |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | adhesin, binds plasminogen, binds fibronectin, laminin, collagen type IV, vitronectin |
| References for function | Wang J, Li Y, Pan L, Li J, Yu Y, Liu B, Zubair M, Wei Y, Pillay B, Olaniran AO, Chiliza TE, Shao G, Feng Z, Xiong Q. Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) moonlights as an adhesin in Mycoplasma hyorhinis adhesion to epithelial cells as well as a plasminogen receptor mediating extracellular matrix degradation. Vet Res. 2021 Jun 3;52(1):80. doi: 10.1186/s13567-021-00952-8. PMID: 34082810; PMCID: PMC8173509. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |