| General Information |
| MoonProt ID | 4113 |
| First appeared in release | 4.0 |
| Name(s) | Glyceraldehyde-3-phosphate dehydrogenase |
| UniProt ID | E7FX85 |
| GO terms | "GO:0000166 nucleotide binding
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0050661 NADP binding
GO:0051287 NAD binding
GO:0006006 glucose metabolic process" |
| Organisms for which functions have been demonstrated | Erysipelothrix rhusiopathiae ATCC 19414 |
| Sequence length | 349.0 |
| FASTA sequence | ">tr|E7FX85|E7FX85_ERYRH Glyceraldehyde-3-phosphate dehydrogenase OS=Erysipelothrix rhusiopathiae ATCC 19414 OX=525280 GN=gap PE=3 SV=1
MVYNKNVNYKEDIDTMTVKVAINGFGRIGRLATRLLTGSKDMEIVAINDLTDAATLAHLL
KYDSAQGRFEHDIEVKDGAFVIDGHEIKVLSERDPKNLPWKELGVDVVIECTGFFTTEEK
AGMHLEAGARKVIISAPATGDIKTVVYNTNHEILDGSETVISGASCTTNCLAPMAAVLND
KYGIISGTMTTIHAYTNDQNTLDGPHAKGDLRRGRAAAQSIIPNSTGAAKAIGLVIPELQ
GKLDGGAHRVPVITGSITELVAVVEKATSVEEVNAAMKAAANESFGYTEEQLVSTDIIGM
SYGSLFDATQTKVSSIGGVNLVKVASWYDNEASYTNQLVRTAHYVASKF" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | 0 |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, glyceraldehyde 3-phosphate dehydrogenase, catalyzes the reversible oxidative phosphorylation of glyceraldehyde 3-phosphate to 1,3-bisphosphate coupled with reduction of NAD+ to NADH |
| References for function | _ |
| E.C. number | EC:1.2.1.- |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | adhesin, binds host cells, fibronectin and plasmimogen |
| References for function | Zhu W, Zhang Q, Li J, Wei Y, Cai C, Liu L, Xu Z, Jin M. Glyceraldehyde-3-phosphate dehydrogenase acts as an adhesin in Erysipelothrix rhusiopathiae adhesion to porcine endothelial cells and as a receptor in recruitment of host fibronectin and plasminogen. Vet Res. 2017 Mar 21;48(1):16. doi: 10.1186/s13567-017-0421-x. PMID: 28327178; PMCID: PMC5360030. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | Cell surface/membrane |
| Comments | |