| General Information |
| MoonProt ID | 420 |
| First appeared in release | 3.0 |
| Name(s) | Integrin-like protein, gene: INT1 |
| UniProt ID | A0A1P8YR90 |
| GO terms | GO:0007229 integrin-mediated signaling pathway |
| Organisms for which functions have been demonstrated | Candida albicans (yeast, a fungi, can cause candiadiasis) |
| Sequence length | 108 amino acids |
| FASTA sequence | >tr|A0A1P8YR90|A0A1P8YR90_CANAX Integrin-like protein (Fragment) OS=Candida albicans OX=5476 GN=INT1 PE=4 SV=1
QQQQQLSQTDNNLIDEFSFQTPMTSTLDLTKQNPTVDKVNENHAPTYINTSPNKSIMKKATPKVSPKKVAFTATNPEIHHYPDNRVEEEDQSQQKEDSVEPPSIQHQW |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
moonID_420_uniID_A0A1P8Y is 108 residues long, with 108 residues (100.00%) predicted as disordered.The protein has 0 short (< 30 residues) disorder segments and 1 long (>= 30 residues) disorder segment.
Segment 1 - Long (>= 30 residues) disordered segment Segment is located between positions 1 and 108 in the sequence. The segment is 108 residues long (100.00 % of the total sequence length). |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | inhibits opsonization and phagocytosis due to competition with CR3 |
| References for function | 2961817 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | NA |
| Comments | NA |
| Function 2 |
| Function description | adhesin, contributes to significant increase in yeast cell adhesion to human epithelial and endothelial cells |
| References for function | 2138655 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | cell surface |
| Comments | NA |