| General Information |
| MoonProt ID | 421 |
| First appeared in release | 3.0 |
| Name(s) | VP40 |
| UniProt ID | Q05128 |
| GO terms | GO:0020002 host cell plasma membrane
GO:0046755 viral budding
GO:0016032 viral process
GO:0039702 viral budding via host ESCRT complex
GO:0039660 structural constituent of virion
GO:0033644 host cell membrane
GO:0055036 virion membrane
GO:0033645 host cell endomembrane system
GO:0016020 membrane
GO:0019012 virion
|
| Organisms for which functions have been demonstrated | Ebola virus (virus) |
| Sequence length | 272 amino acids |
| FASTA sequence | >sp|Q05128|VP40_EBOZM Matrix protein VP40 OS=Zaire ebolavirus (strain Mayinga-76) OX=128952 GN=VP40 PE=1 SV=1 MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
moonID_421_uniID_Q05128 is 326 residues long, with 37 residues (11.35%) predicted as disordered.The protein has 1 short (< 30 residues) disorder segment and 1 long (>= 30 residues) disorder segment.
Segment 1 - Long (>= 30 residues) disordered segment Segment is located between positions 28 and 58 in the sequence. The segment is 31 residues long (9.51 % of the total sequence length).
Segment 2 - Short (< 30 residues) disordered segment Segment is located between positions 321 and 326 in the sequence. The segment is 6 residues long (1.84 % of the total sequence length). |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Interacts with cell membrane, when dimer |
| References for function | 23953110 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | cell membrane |
| Comments | the NTD-to-NTD interface that assembles the native VP40 dimer and the CTD-to-CTD interface by which dimers further assemble |
| Function 2 |
| Function description | Needed for virus budding, when linear hexamer |
| References for function | 23953110 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | NA |
| Comments | hexameric structure comprised of three VP40 dimers, hexamers further assemble into uninterrupted filamentous structures via the CTD-to-CTD interface |