| General Information |
| MoonProt ID | 423 |
| First appeared in release | 3.0 |
| Name(s) | Peroxiredoxin-5, Peroxiredoxin V (Prx-V), Antioxidant enzyme B166 (AOEB166), Peroxisomal antioxidant enzyme, Thioredoxin peroxidase PMP20, gene: PrdxV |
| UniProt ID | P99029 |
| GO terms | GO:0016209 antioxidant activity
GO:0005102 signaling receptor binding
GO:2001057 reactive nitrogen species metabolic process
GO:0070995 NADPH oxidation
GO:0051354 negative regulation of oxidoreductase activity
GO:0048471 perinuclear region of cytoplasm
GO:0043231 intracellular membrane-bounded organelle
GO:0043066 negative regulation of apoptotic process
GO:0034614 cellular response to reactive oxygen species
GO:0060785 regulation of apoptosis involved in tissue homeostasis
GO:0042744 hydrogen peroxide catabolic process
GO:0032967 positive regulation of collagen biosynthetic process
GO:0016480 negative regulation of transcription by RNA polymerase III
GO:0006979 response to oxidative stress
GO:0005782 peroxisomal matrix
GO:0005777 peroxisome
GO:0005739 mitochondrion
GO:0005737 cytoplasm
GO:0005634 nucleus
GO:0005515 protein binding
GO:0001016 RNA polymerase III transcription regulatory region sequence-specific DNA binding
GO:0004601 peroxidase activity
GO:0005829 cytosol
GO:0031410 cytoplasmic vesicle
GO:0034614 cellular response to reactive oxygen species
GO:0043066 negative regulation of apoptotic process
GO:0043231 intracellular membrane-bounded organelle
GO:0048471 perinuclear region of cytoplasm
GO:0006979 response to oxidative stress
GO:0016480 negative regulation of transcription by RNA polymerase III
GO:0043027 cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005782 peroxisomal matrix
GO:0098869 cellular oxidant detoxification
GO:0043154 negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0006915 apoptotic process
GO:0016209 antioxidant activity
GO:0005102 signaling receptor binding
GO:0042744 hydrogen peroxide catabolic process
GO:0006979 response to oxidative stress
GO:0005782 peroxisomal matrix
GO:0005737 cytoplasm
|
| Organisms for which functions have been demonstrated | Mus musculus (Mouse, mammal) |
| Sequence length | Isoform mitochondrial: 210; Isoform cytoplasmic + peroxisomal: 162 |
| FASTA sequence | >sp|P99029|PRDX5_MOUSE Peroxiredoxin-5, mitochondrial OS=Mus musculus OX=10090 GN=Prdx5 PE=1 SV=2
MLQLGLRVLGCKASSVLRASTCLAGRAGRKEAGWECGGARSFSSSAVTMAPIKVGDAIPSVEVFEGEPGKKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVNDVFVIEEWGRAHQAEGKVRLLADPTGAFGKATDLLLDDSLVSLFGNRRLKRFSMVIDNGIVKALNVEPDGTGLTCSLAPNILSQL
>sp|P99029-2|PRDX5_MOUSE Isoform Cytoplasmic+peroxisomal of Peroxiredoxin-5, mitochondrial OS=Mus musculus OX=10090 GN=Prdx5
MAPIKVGDAIPSVEVFEGEPGKKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVNDVFVIEEWGRAHQAEGKVRLLADPTGAFGKATDLLLDDSLVSLFGNRRLKRFSMVIDNGIVKALNVEPDGTGLTCSLAPNILSQL |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Use FASTA sequence on the MFDp2 webserver.
moonID_423_uniID_P99029 is 210 residues long, with 0 residues (0.00%) predicted as disordered.The protein has 0 short (< 30 residues) disorder segments and 0 long (>= 30 residues) disorder segments. |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | peroxidase, thiol-dependent |
| References for function | 23831231 |
| E.C. number | 1.11.1.15 |
| Location of functional site(s) | Cysteine sulfenic acid (-SOH) intermediate |
| Cellular location of function | mitochondria, exhibits broad subcellular localization |
| Comments | reduces hydrogen peroxide, alkyl hydroperoxides, and peroxynitrite, biochemical and structural features differ from typical 2-Cys Prdxs, resistant to hyperoxidation by H2O2 |
| Function 2 |
| Function description | signaling molecule |
| References for function | 23831231 |
| E.C. number | NA |
| Location of functional site(s) | Cys48 |
| Cellular location of function | cytoplasm |
| Comments | Prdx directly interacts with Jak2 via its catalytic Cys48 residue, to regulate the Jak2-mediated Stat5 signaling; this, in turn, inhibits LPS-induced IL-6 production, acts as a negative modulator via protein-protein interaction, not peroxidase activity, the mechanism by which PrdxV interacts with Jak2 differs from SOCS1 (Prdx does not contain a SH2 domain), Prdx appears to be involved in LPS-mediated innate immunity |