| General Information |
| MoonProt ID | 425 |
| First appeared in release | 3.0 |
| Name(s) | Peroxiredoxin 2; Prx2, Thioredoxin peroxidase; Thioredoxin peroxidase 2; gene: TPx-2 |
| UniProt ID | Q9Y0D3 |
| GO terms | GO:0055114 oxidation-reduction process
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0051920 peroxiredoxin activity
GO:0098869 cellular oxidant detoxification
|
| Organisms for which functions have been demonstrated | Schistosoma mansoni, blook fluke |
| Sequence length | 194 amino acids |
| FASTA sequence | >tr|Q9Y0D3|Q9Y0D3_SCHMA Peroxiredoxin, Prx2 OS=Schistosoma mansoni OX=6183 GN=TPx-2 PE=2 SV=1
MLLPNQPAPDFEGTAVIGTELRPISLSQFQGKYVLLVFYPLDFTFVCPTELIAFSERAAEFQSRGCQVIACSTDSVYAHLAWTKLDRKAGGLGQMNIPLLSDKNLRISRAYEVLDEQEGHAFRGMFLIDRKGILRQITVNDRPVGRSVDEAIRLLDAFIFFEKHGEVCPANWKPNSATIKPDPVASLSYFSSVH |
| Structure Information |
| PDB ID | None, but close homologue to Prx1 with 67.22% amino acid sequence identity |
| Quaternary structure | dimeric structure |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-7), and C terminus (aa 189-194) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Peroxiredoxin |
| References for function | 1.11.1.15 |
| E.C. number | |
| Location of functional site(s) | Cysteine sulfenic acid (-SOH) intermediate |
| Cellular location of function | cytoplasm |
| Comments | higher level of Prx found in SEA compared to SWAP |
| Function 2 |
| Function description | regulator of host Th2 modulated immune response when secreted |
| References for function | NA |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | secreted by cells |
| Comments | induces the expression of Ym1 in macrophages independent of antioxidant activity, induces development of Th2 immune responses, the abundance of Prx2 correlates with the ability to induce Ym1 expression and promote polarized Th2 immune responses, the removal of enzyme activity has no effect on this functionality, antioxidant can function without cytokine stimulation |